CAZyme Information: MGYG000004435_00422

Basic Information

• Species: UBA7597 sp900767195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900767195
• CAZyme ID: MGYG000004435_00422
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		42668.51	5.9707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004435	1980556	MAG	Israel	Asia

• Gene Location: Start: 37632; End: 38732 Strand: -

Full Sequence      

MQKFTGFERGMGVGGWLTNYKRFNVLPEEWRKGITIGDREHFATYITEKDVEYIASLGVD
HIRLAFDQIVLQEESGAFREEIVALIDRFIDRCEKYGLNVVLNLHKAVGNYCDISENRSL
LQDSALQEGFIGFWKAMERRYAAKPGLAFELLNEVRNEPPELWNDLASRTISALRAMNGE
RKIILGSTCWNDCARLKDLKIFNDENVIYTFHFYAPFEFTHQRGVLQAAPCYYNREMPYP
GEIERYRDYQRTVSGEKNAYAGFEKMDERYLRAALAPAIEFKKAHPDKILWCGEFGTIRH
TKTEWRENWLRDVIGILKENEIPYCVWNYLSAPYDGNRFSLIDDDTRRILSEKLARIIRG
EIGCGE

Enzyme Prediction     

No EC number prediction in MGYG000004435_00422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	38	331	3.8e-84	0.9456869009584664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.85e-25	45	329	23	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.61e-13	41	219	69	280	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45789.1	1.02e-163	1	362	1	364
AOA60286.1	1.97e-70	1	354	1	344
QUL53328.1	3.97e-68	1	334	1	319
BAJ62400.1	5.15e-68	1	329	1	320
CUH93289.1	1.63e-65	1	329	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	7.32e-65	5	358	2	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.05e-64	5	358	2	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
7EC9_A	1.35e-21	48	353	39	324	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	4.73e-21	48	353	39	324	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3AMC_A	8.84e-21	32	332	14	291	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	7.20e-65	5	358	2	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	7.20e-65	5	358	2	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	5.65e-64	5	358	2	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	3.22e-33	1	322	1	286	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	4.19e-17	48	344	334	642	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004435_00422.