CAZyme Information: MGYG000004435_01286

Basic Information

• Species: UBA7597 sp900767195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900767195
• CAZyme ID: MGYG000004435_01286
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		75847.87	5.1746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004435	1980556	MAG	Israel	Asia

• Gene Location: Start: 53316; End: 55301 Strand: +

Full Sequence      

MQGKFICHKDFSSLKPIDVFHKEHENKSLPKTEEKYKNRHILFRKKFTLADYQTAMICIT
ADDYFKLYINGKFVMQGPPPSYPNAYLYMQKDVSEYLRRGENVIAVHTYYQGLINRVWVS
GDLRESFWCELTVDGEIVAASDESWKCANHTAYSACGVFGYDTAYAERYDSRAKEVGFEK
AEYNDESWENASVYENADYRLEKSPIEPLEVYCVSPQRIERKENVYFIDFGREYAGQLYA
KAKGNRGDEIVMRYGEELSGENEVRYNLRCNCKYEEKWMLSGGDDETDQFDYKAFRYAGI
IAPGGVEIGDIKMLVRHYPFEKKAVYETTNADLRKVLKLCEDTIHYGTQEVFVDCPTREK
GQYLGDAYISGRAQAILTGDATLLKKTIVDFCNSAFISAGIMAVSTSSFMQEIADYSLLF
APLVLWTYRFDRDEAFLKRVYPYVKGAFEYFCGYENERGLLENVTEKWNLVDWPENLRDG
YDFPLTNPIGNGAHNVINAFWIGFLKAFDELSGIMGLLVTGKAERTEKNYIEAFYNEETG
LFCDSTAKKHSAIHSNVLPLYFGVKKNDRAFVKNAVKFIEEKRLTSMGVYMSYFALAALK
KNGEEEKAVALATDKNAWLNMIAEGGTATFEAWGKEQKWNTSLFHPWAVAPLIVFSEVDL
L

Enzyme Prediction     

No EC number prediction in MGYG000004435_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	221	657	4.3e-79	0.8611111111111112
CBM67	34	196	3.1e-36	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.93e-24	321	647	1	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.38e-10	54	193	5	152	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.95e-09	219	317	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	0.002	43	106	69	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20286.1	1.54e-187	2	657	6	669
QCT01521.1	5.10e-186	3	657	7	668
AVM43798.1	4.09e-179	2	658	76	746
AYQ75662.1	4.12e-179	34	657	18	645
QQQ94267.1	1.75e-177	11	657	14	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.98e-18	42	635	178	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	4.98e-08	55	146	40	130	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.42e-06	207	651	76	534	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.49e-14	43	646	187	827	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004435_01286.