CAZyme Information: MGYG000004436_00374

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696
• CAZyme ID: MGYG000004436_00374
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		27434.23	4.9977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004436	1421600	MAG	Israel	Asia

• Gene Location: Start: 2151; End: 2867 Strand: -

Full Sequence      

MAILTYDEKQFYLDGKPYRIISGAMHYFRIPREYWRDRLMKLRECGFNTLETYTCWNLHE
PEEGKFDFSGMLDLAAYIDLAAELGLNVILRPGPYICSEWDFGGLPAWLLKYDKIALRCN
DPAFLEKVRRYYHALFDEVGDRLSTRGGNVVMVQIENEYGSYGNDHDYMRAVVDIYRECG
VDCLLFTSDGACDWMLNGGTLPEYLSVANFGSRAKQNFDALNDFRKKGNRSMGPTMCG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	227	6.1e-84	0.6938110749185668

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.51e-101	10	237	1	228	Glycosyl hydrolases family 35.
COG1874	GanA	1.79e-45	6	222	3	223	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	1.80e-37	1	160	27	188	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	2.87e-15	31	168	8	146	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX64915.1	7.40e-94	1	225	1	225
AIQ22730.1	8.36e-94	1	227	1	227
SMF90826.1	4.66e-93	1	227	1	227
AYB44792.1	5.82e-93	1	225	1	225
QOT12690.1	5.82e-93	1	225	1	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	1.86e-80	1	237	15	245	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	1.99e-78	11	237	10	236	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	1.93e-70	4	228	18	246	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	1.61e-62	1	212	8	221	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.33e-62	1	212	32	245	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	1.15e-73	10	238	36	264	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
P23780	1.45e-69	4	228	35	263	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
O19015	2.51e-66	4	214	35	247	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q9TRY9	3.60e-65	4	214	35	247	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q58D55	2.93e-64	4	210	33	241	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004436_00374.