CAZyme Information: MGYG000004439_00792

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1810; UMGS1810
• CAZyme ID: MGYG000004439_00792
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000004439_20|CGC1	45721.97	5.4376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004439	2174785	MAG	Israel	Asia

• Gene Location: Start: 13230; End: 14435 Strand: -

Full Sequence      

MEKVKMGIIGLGCRGHGLMKDIILECGKAEVTVVCDVYEDRCEKAAETVYEKTGRKPQQT
TDYHDVLDKSKVDCVLITTSWQTHIPIAIEVLRAGIPLALEVGNAYSIQQCWELVRAWEE
THTPFMFMENCNYGRYELMALNMKNMGIFGDIIHCAGGYHHFLAEEICFGRENRHYRLDN
YLKRNCENYPTHELGPIARMLDINYGNRMLSLTATASKSVALHEYLKNKKADDSVLLNSH
FNQGDVVSTAIKCANGETIALTLDTCAPGFYNRGFTVIGTKCRYDEITNSIFFADDTELE
FSWKKEYNNVDTKYIEKYEHPIWQKYQKDGVQGSHDGMDWLEFNEFFDRLIEGKPHRIDV
YDAASWMSIGCLTEQSIALGGAPVAIPDFTDGKWITRKISD

Enzyme Prediction     

No EC number prediction in MGYG000004439_00792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	396	6e-128	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.02e-15	1	388	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.26e-08	4	126	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	3.29e-167	1	397	1	398
QBE96673.1	1.44e-165	1	395	1	390
QIB57148.1	2.04e-165	1	395	1	390
QMW80076.1	2.04e-165	1	395	1	390
QTH41319.1	8.67e-162	2	398	6	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.99e-79	2	398	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.14e-62	1	396	40	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	4.51e-08	4	152	24	166	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.09e-78	2	398	19	435	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.40e-78	3	398	49	461	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.29e-77	4	398	53	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
B2FLK4	1.78e-72	2	398	32	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	2.78e-70	4	398	43	436	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004439_00792.