CAZyme Information: MGYG000004440_01031

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-449; CAG-449
• CAZyme ID: MGYG000004440_01031
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000004440_11|CGC1	62946.47	9.6241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004440	1765228	MAG	Israel	Asia

• Gene Location: Start: 19914; End: 21560 Strand: +

Full Sequence      

MKKKPTLYVIIIFIWILCLGLLITSLYFILNNLDTSNLIRSIFIGIILILNSIILGILWF
GSIKDLVFSCTHAFYGKKLLRKYDDISKIKIKKDYRPKFLLLYCTRNDFNKNALTESMKQ
NYDNFQVIILDDSDKEEFLNEIDLFSKENNIEVVRRKNKSGFKAGNLNNYLKGKTDYDYF
VVLDSDEILPTDYINKVLKYFIYDKNCGAVQARHKATKGNNWFQRLLGLSVGSNGASVQI
VKNFYGSNALIGHGMTISKDCYLKTGGFPLVVAEDISFAVDIRNAGFNIIYAPDILCYEE
FPINYLSLKKRQCKWTQGNLEYMQKYNKEIGSCKMSWFEKLDLKLSHYSLPIVPILGFFL
AVFTIILGFLGYPIIHYSLGIYIIMIIFLCSPLIPDLFVYHKDKNIFLLIPYFILNIITY
ASLSPMMIKTVFLGIFGKKATFNVTPKDNKKYSLKLAFLGSLDSIIFGIIILTLSILSCR
SVLPVILILISCLSAPLVILLSNLEIKEKVKKISNIKEKDNTKFITKDNYQNIHIKNNNI
QISQKEFN

Enzyme Prediction     

No EC number prediction in MGYG000004440_01031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	108	309	1.1e-20	0.8956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.83e-23	73	451	30	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	9.49e-23	111	321	18	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	3.83e-19	118	275	20	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	9.10e-19	123	318	31	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
COG2943	MdoH	2.14e-18	113	512	166	616	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC01535.1	7.00e-171	1	517	1	521
QDL20008.1	9.91e-171	1	517	1	521
QDL19322.1	9.91e-171	1	517	1	521
QIN44161.1	9.91e-171	1	517	1	521
QIN44840.1	9.91e-171	1	517	1	521

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3D3U0	3.13e-10	147	343	198	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=opgH PE=3 SV=1
A6WMM7	3.13e-10	147	343	198	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS185) OX=402882 GN=opgH PE=3 SV=1
A9KZ13	3.13e-10	147	343	198	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS195) OX=399599 GN=opgH PE=3 SV=1
B8E7D2	3.13e-10	147	343	198	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS223) OX=407976 GN=opgH PE=3 SV=1
Q0HUS0	5.45e-10	147	343	198	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-7) OX=60481 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000006	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
39	61
222	241
348	370
377	399
414	436
456	478
482	504