CAZyme Information: MGYG000004443_00004

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae
• CAZyme ID: MGYG000004443_00004
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	MGYG000004443_1|CGC1	63608.02	7.0096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004443	2430140	MAG	Israel	Asia

• Gene Location: Start: 2628; End: 4298 Strand: +

Full Sequence      

MFRQIVLPCFAAWLLSISLATYADSTPGRNNPVKFKIDVSERGAVVTNVVSNINIWDYRS
WLGPKDKEFPGYFKKYMPFIKYVQLMMAAGGNAERDLFDHPLDSDTLTDYNFSKLIEACH
NITKQGLTPHLKIGNVPLKFTTKPKISQAFGVNILPPDSFQVWHHYVMELGKALVKEFGK
KNVRNWRFGVLTEYENKDWFSVNDNPQETKTAYFKLYDYTVDALQKSIDPEIFVGGHSMT
VSEGLWDEREFISHCATGTNFCTGQQGTRLCYLTSSYYDKTPGQYADKSLVECISLLREH
ARQAGFNNLIYGVDEGRILQGTDHKDLVPRAIGNTWQAAYDARMFKTLIDHDIDYFSHWA
FTTRGLWGGIPSVSLHTANLFYTLAGNTRVATENLSLTQSPLDKEIANTDCIAAIDKRKG
KLYLMFYAYSDSVFEKKERTISCRIEGLNKSLHHAIITRTLVSDDSNFFDEWEQDQQKRH
ITDDDFGWSKSSFVIDHPTLKKRQHIDYFRGRESFYGRCSELKPKTSSIDIHEGNATLSF
SLPVHGVVLYEIENVL

Enzyme Prediction     

No EC number prediction in MGYG000004443_00004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	108	474	1.1e-27	0.8352668213457076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.25e-13	110	376	74	325	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41587.1	3.02e-116	34	554	33	565
BAZ42461.1	1.77e-69	31	555	44	567
QEG33890.1	2.28e-33	11	447	13	430
APY11634.1	5.31e-31	36	447	57	447
AJR04496.1	2.32e-30	36	552	52	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YYH_A	1.69e-13	102	556	92	506	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
3W81_A	7.30e-08	110	351	83	303	Humanalpha-l-iduronidase [Homo sapiens],3W81_B Human alpha-l-iduronidase [Homo sapiens],3W82_A Human alpha-L-iduronidase in complex with iduronic acid [Homo sapiens],3W82_B Human alpha-L-iduronidase in complex with iduronic acid [Homo sapiens]
4KGJ_A	7.30e-08	110	351	83	303	Crystalstructure of human alpha-L-iduronidase complex with 5-fluoro-alpha-L-idopyranosyluronic acid fluoride [Homo sapiens],4KGJ_B Crystal structure of human alpha-L-iduronidase complex with 5-fluoro-alpha-L-idopyranosyluronic acid fluoride [Homo sapiens],4KGL_A Crystal structure of human alpha-L-iduronidase complex with [2R,3R,4R,5S]-2-carboxy-3,4,5-trihydroxy-piperidine [Homo sapiens],4KGL_B Crystal structure of human alpha-L-iduronidase complex with [2R,3R,4R,5S]-2-carboxy-3,4,5-trihydroxy-piperidine [Homo sapiens],4KH2_A Crystal structure of human alpha-L-iduronidase complex with 2-deoxy-2-fluoro-alpha-L-idopyranosyluronic acid fluoride [Homo sapiens],4KH2_B Crystal structure of human alpha-L-iduronidase complex with 2-deoxy-2-fluoro-alpha-L-idopyranosyluronic acid fluoride [Homo sapiens],4OBR_A Crystal structure of human alpha-L-iduronidase complex with alpha-L-iduronic acid [Homo sapiens],4OBR_B Crystal structure of human alpha-L-iduronidase complex with alpha-L-iduronic acid [Homo sapiens],4OBS_A Crystal structure of human alpha-L-iduronidase in the P212121 form [Homo sapiens],6I6R_A New Irreversible a-l-Iduronidase Inhibitors and Activity-Based Probes [Homo sapiens],6I6R_B New Irreversible a-l-Iduronidase Inhibitors and Activity-Based Probes [Homo sapiens],6I6X_B New Irreversible a-l-Iduronidase Inhibitors and Activity-Based Probes [Homo sapiens]
6I6X_A	7.30e-08	110	351	83	303	NewIrreversible a-l-Iduronidase Inhibitors and Activity-Based Probes [Homo sapiens]
4MJ2_A	7.45e-08	110	351	109	329	Crystalstructure of apo-iduronidase in the R3 form [Homo sapiens],4MJ2_B Crystal structure of apo-iduronidase in the R3 form [Homo sapiens],4MJ4_A Human iduronidase apo structure P21 form [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	1.72e-17	103	362	73	317	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P35475	4.08e-07	110	351	109	329	Alpha-L-iduronidase OS=Homo sapiens OX=9606 GN=IDUA PE=1 SV=2
P48441	5.30e-07	110	274	99	250	Alpha-L-iduronidase OS=Mus musculus OX=10090 GN=Idua PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000500	0.998708	0.000237	0.000198	0.000170	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004443_00004.