CAZyme Information: MGYG000004449_01281

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245
• CAZyme ID: MGYG000004449_01281
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885		96897.79	8.3719

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004449	1509316	MAG	Israel	Asia

• Gene Location: Start: 1364; End: 4021 Strand: -

Full Sequence      

MSRSDKRKEHNKDNKPVKNTKKRNKETTKSGKKQGFWKRHKKFATFLKVMVVLFILVCIA
GAGAIIALFNNDDWAMKREDLTSKSVDTIIYDKDGTEIANVSGEEKRRTVTLDEVPQMLQ
DAYISIEDERFYTHHGVDIKRTLGATATYIIRRGSSSYGGSTITQQLVKNLMNDDDDSGV
AGIQRKIREMSRAYKLEQWFSKQQILELYLNTIFVGSDVYGVQLGARYYFDKSVQDLDLA
ECAFLAGINHAPNSYNPFGEKDNSERIKNRTKTVLSKMLELGKITQEEYDSAKQEVEDGL
KFSQGNTSSGTSMSYLARAAYNQVIKEFAAEKDVSTKIATQMIAGGGYKIYTTQDSTIQG
YAEEVYRSGDHIFYGVATKNGEKVNSGHTQSAIVIIDHKTGYVVGCMGGLGDDVDSNGQN
RATQSPRQPGSSIKPLAAVAPALESGIITAATVYDESRTSFGNYSPNPHSGYDLVTVRKA
IEFSANTVNVKIMDEVGPANSIAFMRKMGISTLITAKENAEHNDENLSLVLGGATEGITP
LEMAGAYATIANGGVYITPTFYTKVEDSSGSVVLEPKQEKNRVMSEANSYILKSILTGPV
TGSNGTATSAKISGQATAGKTGTTNDNYDRWFCGFTNYYTAAAWYGFDIPENLYYAGANY
PNRAASLWTSVMKKIHSGLESNTSFEKPSNIVTAKICKTSGKVATDDCTDTYTEYFVKGT
VPDYCDGHTKLTICKDTGKIATEFCPNTEEKTYTKKPEKENTTLWKTNDGDKYNIPTETC
TTHTKKTIKVTNVVGKKQADAKAALEKLGLKVTVETKTSTKDDGIVLSQSLKEGTEVKTG
DKITIVVSKKKTSAANEVVNNTVTPSNNTVSNNTTGKNTISSNEV

Enzyme Prediction     

No EC number prediction in MGYG000004449_01281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	94	278	7.4e-61	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	3.59e-174	106	678	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.65e-172	37	705	7	626	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.91e-138	41	722	2	764	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.66e-81	90	757	39	638	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.16e-74	105	725	145	729	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66566.1	1.36e-136	28	728	7	719
QCX34227.1	1.75e-135	61	778	38	758
AEV70266.1	1.99e-134	28	728	11	705
ADD01592.1	2.29e-133	47	728	29	707
ADH60128.1	2.29e-133	47	728	29	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	9.22e-84	75	722	10	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	8.40e-61	195	680	2	462	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	5.92e-59	90	691	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	1.60e-58	90	722	23	768	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG7_B	2.73e-56	195	655	2	440	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	2.04e-111	43	730	13	704	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	2.04e-111	43	730	13	704	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	2.65e-111	43	730	13	704	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0TNZ8	9.02e-105	38	731	19	727	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q891X1	3.69e-104	45	729	20	714	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999881	0.000130	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
46	68