CAZyme Information: MGYG000004456_00283

Basic Information

• Species: Prevotella sp900556795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556795
• CAZyme ID: MGYG000004456_00283
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000004456_2|CGC2	80089.3	8.6839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004456	3541309	MAG	Israel	Asia

• Gene Location: Start: 69685; End: 71793 Strand: +

Full Sequence      

MKFIYLTIVLALATCFNAKAQKGYKNVLRETNMAFFKTAQAKQVGDQILAYQRITGGWPK
NIDMVKPMSDEEMEKVLSEKTRQDDSTTDNDATNMQMLYLARLYQATKTPKYKEAFCKGV
EYLLSGQYANGGWPQFWPKMRDYQIHITFNDDAMVNTMKLLRDVYKQKAPFNKGLTDKNL
REKARKAFDKGVDCILRCQIRVKGKPTVWCQQHDRETFAPAPARAFELASFCSSESARIV
KLLLEIPNPSEEIKEAIRGAMQWFDDYKLTGLKVVRTGEYGSPYRNTTLVKDPAGTPLWA
RFYDLKNCEPFVCDRDGIPRKSMQEIGTERRNGYGWYQDAPAILYPLYQKWAEKYDKAHL
LNISLNTKGKNETGQLDLTHFSKPDLSNFNAIVKAGETIQAAIEKAPANSVTPYIIYVRN
GKYHEKVIIDKPNIVLVGENRDSVIIEYAETAQSQTIKQYKGKDVHQGVIVLTEDANDCV
ISGITVYNNYGSTVEKTTTHQMAIFGRGTRTIITNSNIYADGNDALSLWCKEDGMYYHAD
LFLRCPGVDFICPRGTCYATRCKFLGDSRAIIWHDGRGDINNKFVITNSSFDALSPTKLG
RYHHDHQFYLINCKMSKNILDSNISYAYTDKVLDPCPWGQRVYYYGCEREGGNSGWLSDN
LSTAPGSPAFHAVTAKWTFMGKWDPEARLRSLWHVLKYQVEY

Enzyme Prediction     

No EC number prediction in MGYG000004456_00283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	52	342	1.3e-115	0.9895833333333334
CE8	397	622	5e-33	0.7743055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	3.09e-142	52	342	1	286	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.04e-111	52	341	1	286	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG4677	PemB	5.24e-12	387	644	79	369	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02497	PLN02497	4.66e-10	398	601	46	246	probable pectinesterase
pfam01095	Pectinesterase	2.50e-09	398	446	14	64	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61703.1	0.0	21	698	30	707
ALK83448.1	0.0	17	698	32	713
QEW34712.1	0.0	17	698	32	713
QQY38928.1	0.0	17	698	32	713
QJR66036.1	0.0	17	698	32	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	4.31e-55	22	354	64	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	3.71e-50	37	336	29	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	4.91e-49	37	336	29	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]
1QJV_A	2.47e-08	387	604	2	246	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	2.47e-08	387	604	2	246	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A8	4.87e-08	387	604	26	270	Pectinesterase A OS=Dickeya chrysanthemi OX=556 GN=pemA PE=1 SV=1
P0C1A9	1.51e-07	387	604	26	270	Pectinesterase A OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000491	0.987760	0.011114	0.000215	0.000191	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004456_00283.