CAZyme Information: MGYG000004456_00995

Basic Information

• Species: Prevotella sp900556795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556795
• CAZyme ID: MGYG000004456_00995
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000004456_9|CGC1	78680.58	8.452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004456	3541309	MAG	Israel	Asia

• Gene Location: Start: 6926; End: 8995 Strand: +

Full Sequence      

MEMKTKTLFAAMSFLTICSMAAQAQIPQQSIRWDKHSLIFDGKRVVPVMGEVHYSRIPQD
EWREEVRKMKEGGVTMIAAYVFWNHVEEVEGVFNWSGQRNLRGFLEICKQEEMLVVLRLG
PFCHGEVRNGGIPDWMFTKGCRMREENTTFLKYTTELYRQIYSQVQGLQWKDGGPVVAAQ
FDNEYRGRGSYLMALKKIAQQIGFDLPFYTRTGWPELKTPVPFGEMVPLYGDYADGFWER
SLKEAAGNYYKAFNFKAFRSSTAIATEQLGKQEAKINKGDEAYPYFTCELGGGMMTSYHR
RPYIYPEDAYSLAIIKLGSGSNLLGYYMYHGGTNPTAMMPGNLDDGSAVYLNENQRTQAT
NYNDMPVKTYDFQAPLGEFGQKNAHYFMLRKLHLFMHDYAEVLAPMEATFPCSQDIEKGD
DSHLRWSLRSKDKSGFVFINNYERLQQLSARKNVQFEVCGVKFPQRPMTVPAGAMCIFPV
NIDGIRYATAQLIAKRDGKIYLEQIKGIPTEIAVDGKVLKNVKAKGIAKPVYKNIYLVDS
KTAEHLFLQEEGKSMMSLAPSFKKIKEAEGVRKITMGVQKVAEEPSDADFKKAAVYQLNL
SPEMLQGRNLLKIQYRGDCARLYCDGKLVADNFYNGRPFLMGLWRLPADCQKLELRILPL
QKDMPVYFPREADVAKEGEEIVKLEITQQ

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	38	393	7.9e-86	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.04e-53	37	393	1	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	4.95e-29	30	393	29	339	beta-galactosidase; Provisional
COG1874	GanA	7.42e-14	37	191	7	167	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	4.90e-08	58	191	8	144	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37835.1	0.0	3	686	1	672
AGB28883.1	7.94e-286	30	686	344	1027
ATC65137.1	8.45e-184	34	669	66	796
ACB74649.1	5.11e-169	34	672	52	801
AAO79265.1	1.31e-168	3	671	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	4.31e-29	30	492	7	398	ChainA, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	2.36e-28	30	492	7	398	ChainA, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4E8C_A	3.30e-27	41	392	13	325	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3THC_A	1.59e-23	31	392	11	330	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	1.70e-23	31	392	35	354	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2X2H7	3.41e-30	15	455	22	403	Beta-galactosidase 4 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_006270 PE=3 SV=1
Q6Z6K4	4.54e-30	15	455	22	403	Beta-galactosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0219200 PE=2 SV=1
Q9SCV1	1.34e-28	29	506	39	447	Beta-galactosidase 11 OS=Arabidopsis thaliana OX=3702 GN=BGAL11 PE=2 SV=1
Q6ZJJ0	4.15e-28	31	393	33	343	Beta-galactosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0549200 PE=2 SV=1
Q9SCV9	1.63e-26	28	443	30	386	Beta-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BGAL3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000694	0.866055	0.132258	0.000426	0.000298	0.000244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004456_00995.