CAZyme Information: MGYG000004456_02129

Basic Information

• Species: Prevotella sp900556795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556795
• CAZyme ID: MGYG000004456_02129
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	MGYG000004456_25|CGC1	32030.58	7.7985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004456	3541309	MAG	Israel	Asia

• Gene Location: Start: 17776; End: 18612 Strand: +

Full Sequence      

MNMKSTCMACCLLMMGCISGSAKDNKSEKTNKYKLVWQDHFKGKTFDSKSWSKIPRDRPD
WKRHMSYDDRLYEVKDGTLILHGVNNDGSYKYDLNSDGKLEADTARFVTGGLYTKHKRTI
EYGKVEVRAKLGQAQGAWPAIWMLPDRDIAWPNGGEIDIMEHLNFDPMAYQTVHTHYTHT
LKQDMNPPHFATGKIDTNGYNVYAVEILPDELIFSINGEKTFSYPRIQTDKEGQYPFGAP
YYLLIDMQIEGSWVGKADPSQLPVKMEIDWVKMYKLKK

Enzyme Prediction     

No EC number prediction in MGYG000004456_02129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	37	274	3.3e-52	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.28e-66	37	274	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	9.80e-29	39	274	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
pfam00722	Glyco_hydro_16	1.52e-20	117	272	28	168	Glycosyl hydrolases family 16.
cd08024	GH16_CCF	3.64e-18	112	238	104	242	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
COG2273	BglS	4.60e-17	17	274	24	265	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25177.1	6.24e-117	32	277	25	259
ADV42738.1	8.87e-98	30	277	23	260
AQX06254.1	2.88e-96	12	277	18	270
SQG08214.1	2.88e-96	12	277	18	270
AQX48301.1	2.88e-96	12	277	18	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	3.88e-96	27	277	23	264	ChainAAA, Beta-glycosidase [Bacteroides caccae]
5WUT_A	2.80e-30	34	274	6	234	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
3ILN_A	4.07e-30	33	275	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XOF_A	2.42e-28	33	274	24	266	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.28e-27	33	274	24	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	1.51e-40	30	276	53	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	4.16e-32	13	275	22	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	1.30e-29	35	275	425	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q9Z3Q2	1.09e-10	100	276	294	459	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2
O33680	1.21e-08	61	276	261	459	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001320	0.539450	0.458034	0.000455	0.000409	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004456_02129.