CAZyme Information: MGYG000004456_02391

Basic Information

• Species: Prevotella sp900556795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556795
• CAZyme ID: MGYG000004456_02391
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36993.18	7.8677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004456	3541309	MAG	Israel	Asia

• Gene Location: Start: 35584; End: 36573 Strand: +

Full Sequence      

MKKLFLSFLMMLTMLPLAAANKYDNPDTIVVSRDGTGEFRTIDEAIEVCRAFMEYTKVIY
VKKGVYKEKLIIPSWLTNITICGEDRDQTIITWDDHANIKMPVGGLDSEAAVKGKPMGTF
RTYTLKVQGSYITLKNITIENNAAKLGQAVSLHLEGDHILVQNCRLLGNQDTVYTGIANN
RSAFYDCYIEGTTDFIFGPGRTWFENCEIHCKANSYITAASSPAGQEYGYVFNKCKLTAE
PGIDKVYLGRPWRPYAATLFMNCEMGSHIRPEGWHNWGKQSNEQTARYSEYNNHGAGATT
KGRVAWSHQLTKKEAAKVTIKNVFGEEAW

Enzyme Prediction     

No EC number prediction in MGYG000004456_02391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	324	4.8e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.15e-77	29	322	2	293	Pectinesterase.
PLN02773	PLN02773	3.11e-74	31	317	9	289	pectinesterase
PLN02682	PLN02682	3.06e-72	18	315	60	352	pectinesterase family protein
PLN02432	PLN02432	2.00e-68	29	329	13	291	putative pectinesterase
COG4677	PemB	8.89e-67	26	324	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66521.1	1.68e-211	1	329	1	329
BCS84477.1	8.29e-163	1	324	1	315
QVJ81978.1	2.46e-154	1	329	1	320
ADE82952.1	2.46e-154	1	329	1	320
QJR97878.1	1.42e-152	20	324	13	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.24e-42	29	306	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.01e-39	30	329	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.24e-34	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.72e-33	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.93e-28	32	326	12	336	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.82e-56	31	315	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	4.80e-54	18	315	74	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	3.90e-50	28	329	272	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	2.15e-48	28	329	276	576	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q9FM79	3.53e-48	29	314	82	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.999068	0.000196	0.000156	0.000148	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004456_02391.