CAZyme Information: MGYG000004456_02564

Basic Information

• Species: Prevotella sp900556795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556795
• CAZyme ID: MGYG000004456_02564
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000004456_38|CGC1	45919.71	6.3418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004456	3541309	MAG	Israel	Asia

• Gene Location: Start: 10331; End: 11545 Strand: -

Full Sequence      

MKRNFLKICLLFVSMFTAFSSSASPSVVDTPDASESIPTAQQWNKDVVGWNLGNEFECSA
PGQDGESMQIGNPDGSIHAETAWGNPVVTKKMIQAVKKAGFNAIRIPIRWQCHITNAQAM
SIDKAWIARIKEVVGWCLDNGLKVIINVHHEKWLEGRPTYQYKDENCQKLALLWMNIASE
FANYDSRLAFAGTNEVHIRDNWGKPTAENLEVQNAYNQIFVDMVRATGGNNAKRHLILQT
YVCNPWFGIENGDFIIPKDAEGNGNNYMSVEFHYYQPWSYAGDCTYDYWGDAYKDAGKIP
AENEKTMTDFFDKAVNTWSNKGLGIVIGEWGVTDHYKSNSEKVHENMTYYCKFLTTEARK
RGFSTFVWDNNHFGNGSEKYGIFDRFKSMKVNAPWILEGIFGKE

Enzyme Prediction     

No EC number prediction in MGYG000004456_02564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	80	371	2.3e-87	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.32e-47	80	374	16	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.05e-20	1	387	1	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB91389.1	2.08e-309	1	404	1	404
ASE18437.1	1.21e-308	1	404	1	404
ADK97059.1	1.21e-308	1	404	1	404
AKU68585.1	1.41e-307	1	404	1	404
QUB87538.1	1.41e-307	1	404	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EDG_A	2.60e-66	48	400	31	371	SingleCrystal Structure Determination Of The Catalytic Domain Of Celcca Carried Out At 15 Degree C [Ruminiclostridium cellulolyticum H10]
6PZ7_A	3.01e-58	39	396	8	325	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4IM4_A	8.61e-58	48	400	16	331	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
4X0V_A	5.73e-57	21	400	19	391	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
4YHE_A	6.76e-57	48	384	16	347	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17901	1.60e-64	48	400	56	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28621	6.76e-55	39	398	41	368	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P54937	3.42e-54	1	385	1	360	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P10477	7.37e-54	48	400	66	381	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	1.74e-53	10	398	12	366	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001979	0.987297	0.009781	0.000479	0.000247	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004456_02564.