CAZyme Information: MGYG000004459_00679

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA791
• CAZyme ID: MGYG000004459_00679
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37129.48	8.4499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004459	1336458	MAG	Israel	Asia

• Gene Location: Start: 259416; End: 260417 Strand: -

Full Sequence      

MNNKINKIFIINFGGIGDEILFLPTIISLKKTYPEAKITLCLEKRTKSIKDLTDLIDELY
FVDIKGKNKYSELLKMVLKARFGKYDAILSSGGNKLISVLLFMTGIKTRIGYNTGKLSQM
LLTNAVELNKNQYASKMYHALAMPLTSEVTELPEINVQSQEKIENSILIHPGVSQMSIKK
GIIKTVPAQTWAKVLKLLVEQGKHVILTGGPDDKECIDIIKKECGTFDYDDYTKGQIKSL
KDLAELIGKSEKFLCSDSAPLHVAVAMNTRTYAIFGSTDENKLIPQADFVTAIKSKKHCP
LAPCLWERRQTSCAELTCLDISAEEIVEIVTNS

Enzyme Prediction     

No EC number prediction in MGYG000004459_00679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	310	5.4e-32	0.9155555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.41e-51	7	304	3	304	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.21e-42	7	328	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.21e-20	1	279	1	292	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	5.91e-19	85	305	13	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	2.91e-143	7	330	2	326
AFY67702.1	4.85e-51	14	295	9	299
BAU12214.1	1.42e-50	14	295	9	301
BAI93916.1	1.17e-48	14	295	9	300
QNH55727.1	1.17e-48	14	295	9	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7WFF_a	6.48e-06	14	299	124	429	Chaina, Photosynthetic NDH subunit of subcomplex B 1, chloroplastic [Arabidopsis thaliana],7WG5_a Chain a, Photosynthetic NDH subunit of subcomplex B 1, chloroplastic [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	4.59e-16	17	279	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	6.18e-14	17	279	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999948	0.000083	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004459_00679.