CAZyme Information: MGYG000004459_00851

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA791
• CAZyme ID: MGYG000004459_00851
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		63648.61	9.7953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004459	1336458	MAG	Israel	Asia

• Gene Location: Start: 7868; End: 9508 Strand: +

Full Sequence      

MLDFIKKHPELFTILGLLAFCGMIFFYGIGSYVLMDVDETRYVSMARDMFHSKDYMTLYL
NGVYFFEKPPLYFWGEVLSFLGFGVVNEFTARVPVALYGTLSTLLLYFVGKKVVSRRYGI
VSALILATSVEFLILAKYAILDILLATCVEFAIMSGFLTYFVKEKNKKYCWWAFYFFSGL
AVLAKGIPGFALPFGTMFFVAIFTKRFKELFRPQYLLVGFLIFFAVVLPWHILMLNKYDP
LFFNEYVMKHHVHRFFDSSGVNRKQPFYFFALTILWGFCPWILSSLAILCSKIKKLKNIN
LKFNFEEFSNSQKYMFLNFISFALIFLFFSSSSTKLVTYIVPIYFTMANMLAFSWVKYLE
NGEYDKQINITTHVWFGILLVASIVAMFTQFFLPEKIYADIVSVKWFTIILLFVFGVIGI
LVTKLNKKYLVFATLVAFVTVLSAFGMGRYFNLDYKFGQNDLMKYGKYAIDNNLSIITIN
NPNRYSLNYYGPKKVKFGQYASIQDAFNDGDLKTVFIIRKNELKYYKEIPNYTTIFEGKK
YLLIKP

Enzyme Prediction     

No EC number prediction in MGYG000004459_00851.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	13	443	3.7e-96	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.35e-42	17	450	13	430	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.29e-30	15	435	9	415	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.83e-13	68	230	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.52e-13	14	238	2	238	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	0.004	9	273	22	263	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	5.29e-211	3	545	6	555
ACM19911.1	7.70e-47	1	370	4	360
QEM66831.1	7.54e-43	4	386	9	374
ABQ27847.1	1.13e-42	6	362	10	352
ACH39987.1	9.59e-41	22	364	27	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.25e-20	34	398	54	406	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	2.22e-21	17	433	14	414	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
O67270	3.05e-21	23	384	14	346	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q7N3Q9	9.36e-21	33	442	30	423	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B2VBI7	5.03e-18	34	385	27	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
B4EUL1	2.73e-17	20	385	17	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999829	0.000013	0.000000	0.000000	0.000000	0.000207

TMHMM  Annotations     

start	end
12	34
55	74
89	111
132	154
169	203
215	234
267	289
314	331
336	358
371	393
403	422
429	451