CAZyme Information: MGYG000004461_00805

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_00805
• CAZy Family: CE1
• CAZyme Description: Diacylglycerol acyltransferase/mycolyltransferase Ag85B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		28900.01	6.2274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 97899; End: 98675 Strand: +

Full Sequence      

MAFIQCNFHSESLGMAASMNVILPQTTFSQIGMKGVVNENGTPVLYLLHGLSDDHTIWMR
RTSIERYASELGLAVVMPCVNRSFYNDTPDGMKFWQFVSQELPALVPTFFNVSTKREDTF
VAGLSMGGFGAFKLALNCPDRFAAAASLSGALRNDWLNSGNQALFEFDFGPLDQIKGSAN
DLYFKAEEVVKSGGPRPMLYQVCGTEDFLYQVNIDFRDHLKRIGYDAVFKEGPGNHSWAF
WDAEIQHILKWLPIKGKK

Enzyme Prediction     

No EC number prediction in MGYG000004461_00805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	10	252	5.3e-51	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	3.08e-40	10	258	19	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.22e-16	43	252	25	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.48e-11	43	253	99	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	6.27e-10	9	142	24	168	S-formylglutathione hydrolase
COG3509	LpqC	1.11e-05	41	142	60	169	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIV82330.1	3.85e-17	41	246	71	316
BBL01057.1	4.26e-17	7	250	151	380
QVI28069.1	7.19e-17	43	246	73	316
AAS03926.1	1.81e-16	40	245	71	311
AHC23151.1	1.86e-16	43	246	73	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	2.58e-105	1	255	2	264	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	1.23e-57	1	252	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	5.83e-57	2	252	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	4.30e-54	1	258	8	263	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	4.10e-47	2	257	6	257	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	2.23e-40	1	252	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q06947	6.81e-17	40	245	71	311	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium avium OX=1764 GN=fbpB PE=3 SV=1
Q49575	5.55e-15	40	245	71	311	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium intracellulare (strain ATCC 13950 / DSM 43223 / JCM 6384 / NCTC 13025 / 3600) OX=487521 GN=fbpB PE=3 SV=2
A1AXZ2	1.41e-10	43	156	48	184	S-formylglutathione hydrolase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=fghA PE=1 SV=1
D5EXZ4	7.54e-10	43	252	466	668	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_00805.