CAZyme Information: MGYG000004461_01018

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_01018
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984		112305.56	9.6496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 170011; End: 172965 Strand: -

Full Sequence      

MNYCILFIVLFCSLLHGTLSAATSVDFSKDSLIHFPLLNQEEDQIRIEKSKIPGKEKTGI
SFSWGTRHYHYTQTGISKKPLPQFEKFQKLELALNVFIEPGSSVSQFGLRFRDSQGEIFQ
ISSGRLPAGTHGNQKVHLVFDAEKVPHSWGKKINRKIDWPLTLFSMTVSYPPQSGKGKII
FESIETFLPDRLLESVEVKVDTGHPLHLLFPRKAPPQLSFRNTLNRSISFLTEWNLSDFS
GKNLATSQERLNLSPGNSATISIPWKQSLGIFYVNYKLKATDGSGEFAGKCSFASINPPD
KKNTRENEFLFGVCSHPGRINPEEQELEALAASLCGARYLRTGISWESLERKKGKRDYSR
FDRVVDTFLKHGIETQILLAFTPRWAVSKEGTPVYPKDRRLMFRLPDYDAYASFAEETAR
RYQGKLRFFEIWNEPDIAFGNFTTEQYIKLLRAGYEGIKRGNPEAKVMTAGFTYMPLSDI
PPKPGMMRRTLVEGKGFYDIHAFHGHGPFAHYRPQIPAMLEMRRKEGITAPWYANETADH
SLRGEAHQAVTLFQKLIFSWANGAMGYNWYDLRNDGYDRYEKEHNFGMITRDFQPKAIYP
VYSMLTNLFAPAHFRKTLSPGGGIYLYQFETPDAILLPLWREEGSFPAVLALRTDARKAE
VVDLMGNRKPLTINSNFLLAVPEQTPCTLLLHGAKNVEFSGFVLKFFHPGLQIPGTPAYL
PFVLRNPFPEEQAFQIWSGKHHASYSLKGGTAQNVRLQTDSPEFRWKLGKIFQGKFLLEF
TRARMISAKAHEKPDFVLDREKNRFELFPNNPLMQHMTWKGPKDLSAKIWLQIRKESLLL
DAEVTDDTHVQPYSKSMVWQGDNIQIAFCFPNQTGNWEIGLTRLESGKAEVFFWDTPVKA
NPSAVKLSTERRENRTLYHAAFPFSLLGIKREDLALGFRFNLLVNDNDGNGRKGWMEIAP
GLGIDKSPERFPVLIFPGTNISYR

Enzyme Prediction     

No EC number prediction in MGYG000004461_01018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	355	606	1.1e-29	0.6450116009280742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	5.68e-65	794	976	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.67e-15	818	954	29	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam01229	Glyco_hydro_39	8.39e-08	357	467	75	193	Glycosyl hydrolases family 39.
cd00241	DOMON_like	7.53e-06	817	957	10	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	2.53e-165	56	976	79	1032
AVM47149.1	2.70e-158	177	976	473	1306
AVM46276.1	1.31e-157	174	976	306	1136
AVM44759.1	5.99e-156	197	976	161	964
AHF90198.1	3.63e-154	57	976	54	1005

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999196	0.000150	0.000136	0.000128	0.000133

TMHMM  Annotations     

start	end
5	27