CAZyme Information: MGYG000004461_01047

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_01047
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1087		121589.87	8.9983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 26401; End: 29664 Strand: +

Full Sequence      

MKITFPACTAFQGASYCDGKGVEDLTRSLSFFIKRISGSPPAVIEISEHDPAGKGRECFQ
AHFQYASVGCWTRITIPLSKFRYIRQYGTVSGANQKLDPRKKISIALVRFGKHREESSIA
IDALSWTKDDTPEKAPVPQSTFFSPNRLDGDPDFETGVKEWIPWNLAEPEPLWIQGEGAL
GSHHSMQVRGVCVNKYKWGIVQAGKAYVLSFYAKGEKGDSLNVTMLSPAGAWHRLCSRTF
RLVPEWRRYSIAIPEQKSVAPFYSILLTAPHPSRKVLIDAIQLEEGKRVGPFSPPALCQL
SASTEEPGEIVKSGTIPTMKIRFHTSDPKQLKMPLVFDFSCGDFRKSWKAESVSSAKWEI
SCDFAAVPGYYPGEIRVSDADGHLLIAQKAPFVVAPSFQSRGDFFGIQTSMGTVPAEALK
RIGVARIRFNMDTWAALEPDGPRKLRQGNVLAEKYNRMGFELLGTLLSTFRPPSWALRKG
SRLPSAEAIGNYIRSQAASKAEDLCLELDNEVDWNYRKHAGATMRQAIDIYAELLNAAYP
IVQKQGHCFAFNSTGSKEFSTGIFEKAGKSFDLYAVHPYCSPRVLAEDGRDCSTPENGGF
LNVMKETEALIKKYGNRHSMAIGELGWSLGDSLDYDSLYAHRHAAYLARLFILSRTFPAK
WLIWYVLMNAPESGRFDYGIWRNQSGPRPLPAVAAFAQAAYEFQSIRGLAETILDGDIRL
IQWKTPDSAHFALWNTDAEAKPVEFHIPEAERIVSVYGTPLKGKVFSLTENPVYLSCRIS
QADSLKKQILQSIRNRIPLSLIPGLVRSDRLRLLVRNNQIAPWEGRIRTGGGEKTLRLAP
KETKTVLLDLKTDFPLDRQNSLRVDLIRPGTAPIQTSITLPPLIPIGKRQFKDWKTFEFQ
KEEKVILLSQREHVLPPDPSVPWDGPEDLSAKLFFAWDHEYFYLFAEVVDDVHSNTFQGG
DIWQGDVIQFSFDTRNDALPAAGYDHNDYEFGLALGKKPYCWYSPSGKKGMDETLRTKMN
RSGNLTTYRAAIPWKSLGMSPAAGDVFGFALGIHDRDGNQSGYYLAFGRGVVGHKNPSLG
KKLILKE

Enzyme Prediction     

No EC number prediction in MGYG000004461_01047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	925	1060	8.6e-20	0.7252747252747253

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.63e-40	922	1079	21	182	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	3.51e-23	922	1060	29	164	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.80e-20	921	1067	10	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam06452	CBM9_1	1.06e-09	917	1059	16	153	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44104.1	1.52e-181	1	1087	87	1170
AHF94659.1	2.03e-33	416	1086	6	713
AJY74277.1	2.62e-26	487	1085	401	1087
QTH43804.1	3.35e-21	487	1083	414	1111
AZS16815.1	1.50e-20	486	1078	496	1175

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_01047.