CAZyme Information: MGYG000004461_01134

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_01134
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000004461_6|CGC2	39048.07	6.4929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 142074; End: 143120 Strand: +

Full Sequence      

MAIRKFPISNDPNIYEAWPDVVLSDSGKLICVFSECTHHGNRSYTRVMLTESSDRGRTWT
PKHPLTEGTSGKPYYYNCARINKLSNGKLVITIDKVKRGHAECNADASDVLLYYSSDNGE
SWSQPLPTPMNGIVPDKLTQLPNGRLLLSAHYQEDGKLTQFLHYSDDDGKTWSRRITVAK
SPEYNLCEVSLLPMGNGTVAAFLRENSGLGYDCKKVISHDNGETWGPIIDFPLPGCHRPT
SGFLNDGRILITYRFLQGGMGGWGNSTQNLFAALTDRESVLAEKRFESKVRILPIDYDRS
PVADLGYSGWVQFPDGEIYIVNYIVDDAWDKAQIRGYSLTLDDFLLKK

Enzyme Prediction     

No EC number prediction in MGYG000004461_01134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	19	238	1.9e-26	0.6842105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.26e-28	19	340	17	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.89e-18	115	253	87	227	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	2.64e-07	7	183	111	262	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	7.02e-04	52	173	6	110	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
pfam15902	Sortilin-Vps10	0.005	112	254	3	137	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44758.1	1.42e-177	3	346	2	345
AYB46154.1	3.62e-135	1	347	1	343
ANY72719.1	1.23e-133	1	347	1	343
AHF91127.1	7.11e-122	3	346	2	357
AHF89372.1	3.22e-79	3	346	2	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W38_A	6.89e-06	63	226	9	168	Crystalstructure of the pseudaminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
3H6J_A	6.89e-06	63	226	9	168	Crystalstructure of a putative neuraminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_01134.