CAZyme Information: MGYG000004461_02254

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_02254
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000004461_18|CGC1	44564.7	10.0525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 50316; End: 51509 Strand: -

Full Sequence      

MIPKRKEIWIIAGEASGDLYGARLASELKRRAPDAVISGMGGIEMRKAGVEILVDSSELG
VIGLVEVLSNLFKFIHILLYLIREAKKRCPAAVVLVDYPGFNIRFAKAMWKAGIPVVWYI
SPQVWVWRKGNIKKLAKFCRKLMVIFPFEPEVYEGSGLDVEFVGHPLVDIVQGRADTSIE
RDPNSILLLPGSRKKEIEYLLEPFLKTAVILKSRHPQLEFVAAAPRERILQMIREGIQEF
KRKHPDQSLPEIQLTRGKNAFWMQRCTAGLAASGTVTVECAIAGLPLVVAYRLNKITFLL
ARLVIGKLFRGFFTMVNIILYRRAFEEFLQFQVIPKDLADAMERILPGGERRAEVEKDMK
EMVEAISGGASGAVARAASCVLAVVSERMERQEKKTV

Enzyme Prediction     

No EC number prediction in MGYG000004461_02254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	1.1e-104	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.08e-123	8	388	4	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.29e-108	6	387	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.11e-84	8	365	1	357	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.75e-76	1	383	1	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.30e-44	53	376	42	342	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	2.52e-139	1	367	1	368
AVM45461.1	2.85e-130	5	362	11	369
QQG66459.1	1.95e-72	6	362	14	370
BCG48537.1	6.47e-71	1	362	1	358
SNB45016.1	1.13e-69	10	355	2	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.75e-46	8	362	9	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.22e-45	8	362	9	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	3.84e-64	2	350	3	347	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q83DS5	1.75e-63	6	346	4	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.75e-63	6	346	4	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q2LVL8	5.89e-63	6	362	4	357	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
A9KC41	6.88e-63	6	346	4	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
269	291
298	320