CAZyme Information: MGYG000004462_00024

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004462_00024
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004462_1|CGC1	37129.11	7.9735

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004462	2469543	MAG	Israel	Asia

• Gene Location: Start: 28238; End: 29215 Strand: -

Full Sequence      

MKRILTLLTIMLTAVATTFAADKYDNPDTIVVSRDGTGEFRTIGEAIEVCRAFMDYHKVI
YVKRGIYKEKLIVPQWLTNIEILGEDRDATVITYDDHANIPNPATGRGIGTFRTYTVKVE
GNSITFRNITIENNAARLGQAVALHTEGDRLMFINCRLLGHQDTVYTGVAGTRLFFRDCY
IEGTTDFIFGPSTAWFENCEIRSRADSYITAASTPKDRPYGYVFSHCRLTADANVTKVYL
GRPWRDYGYTLFIGCEMGRHIRPEGWHHWQKERQQTARYMEYGNSGEGAATDRRAPWTRR
LTKKEAAKITMEEVFAINDKWTPEP

Enzyme Prediction     

No EC number prediction in MGYG000004462_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	315	2.3e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	8.25e-79	30	310	2	290	Pectinesterase.
PLN02773	PLN02773	1.85e-71	32	311	9	292	pectinesterase
COG4677	PemB	1.21e-66	27	318	80	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02197	PLN02197	3.78e-64	29	309	276	562	pectinesterase
PLN02682	PLN02682	7.02e-59	29	306	70	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	1.16e-179	1	323	1	322
ADE82952.1	1.16e-179	1	323	1	322
BCS84477.1	3.52e-163	20	323	19	323
AGB28242.1	5.41e-162	7	323	6	323
QJR97878.1	1.43e-158	23	324	15	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.05e-43	30	297	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.94e-42	31	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.79e-36	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.03e-35	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.38e-32	33	323	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	1.22e-53	29	323	272	569	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	1.30e-53	29	309	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q9LVQ0	6.64e-53	32	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q42608	2.01e-51	29	323	259	556	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
O80722	9.88e-50	31	309	278	562	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999138	0.000163	0.000152	0.000144	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004462_00024.