CAZyme Information: MGYG000004462_00151

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004462_00151
• CAZy Family: GH51
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000004462_2|CGC2	74562.82	8.1472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004462	2469543	MAG	Israel	Asia

• Gene Location: Start: 57798; End: 59774 Strand: +

Full Sequence      

MNHRLLTCSIALAAVTASFAQTHVMDVNTKKAGAVVQNTMYGLFFEDINYAADGGLYGEL
VKNRSFEFPQNFMGWQTFGNIELKADGPFERCPHYVVLSDPGHNDRRSGLVNEGYFGIGV
LKGEEYRFTVWAKAPKGSGRITVQLIDPATMGERQEFASVKLEVKSAEWKKYEVRLKSPL
THNKAQLRIYLDGRNAVCLEHVSLFPVNTFKNRENGMRRDLAQALADAHPGVFRFPGGCI
VEGTDLATRYQWKNSIGPVENRPLNGNRWQHTFTHRFYPDYYQSYGLGFYEYFLLSEDMG
AEPLPVLNVGMSCQFQNRNNEKWHVPVNELHPYIDDCLDLIEFANGDTTTTWGRKRAEMG
HPAPFNLKLIGVGNEQWDTLYFERLKPFVKAIKARYPKIRIVGTSGPDSEGKMFEIGWKA
MKELKADLVDEHFYRPEKWFLESGLRYDNYDRKGPKVFAGEYACHGKGKKWNHYEASILE
AAFMTDMERNADVVWMTAYAPLFAHVEGWQWRPDLIWFDNVRMFKSVSYYVQQMYATNKG
TNVLPLTMDGKPVAGQKGQDGLFASAVTDKTDGTVIVKVINTSKTAQPVTLNLNGLKGAS
QATTITLTHDGMDDENTLDRPEKIVPREGTVGVTGDKKGAVINDNLPPMTFRIYKVKK

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	196	656	1.9e-107	0.680952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	9.45e-52	198	658	32	500	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
smart00813	Alpha-L-AF_C	1.67e-47	460	649	1	188	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06964	Alpha-L-AF_C	1.92e-46	460	649	1	191	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam02018	CBM_4_9	1.52e-11	58	192	1	131	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR43413.1	0.0	9	658	10	659
QNL37257.1	0.0	10	658	11	659
QIU95482.1	0.0	9	658	10	659
CBK66692.1	0.0	9	658	10	659
QQR17855.1	0.0	9	658	10	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.29e-90	30	656	7	624	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
6ZT6_A	4.70e-18	215	656	50	493	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
6ZT8_A	4.70e-18	215	656	50	493	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
2VRQ_A	8.29e-18	215	656	50	493	StructureOf An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]
3S2C_A	1.38e-17	214	633	46	463	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	1.75e-132	25	545	37	546	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	7.09e-100	33	658	52	657	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.35e-92	36	651	54	647	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
B8NKA3	7.32e-83	25	637	28	613	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
Q2U790	2.79e-82	25	637	28	613	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000408	0.998654	0.000267	0.000220	0.000216	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004462_00151.