CAZyme Information: MGYG000004462_00235

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004462_00235
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000004462_3|CGC1	58778.93	7.0932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004462	2469543	MAG	Israel	Asia

• Gene Location: Start: 11827; End: 13401 Strand: -

Full Sequence      

MKQRYLILIMSFMSVTSVAFGATRPWDNGRLEVSDNGRFLCHADGTPFFWLADTGWLLPE
RLNRDEAEHYLARCAEAGYNVVQVQVVNGVPAFNAYGQMSMTPDFEFGGQVRGGRSVEGG
GRSVEGGGRNASSAGDISPSTLLPPPSPNLSYGYWDHMDYIVDCAARHGIYVGMVCIWGG
LVKAGHMDEAKAVRYGRFLAERYGRKKNIVWIIGGDIEGSVRTAVWDTLATTIKSLDPNH
LMTFHPRGRTTSAKWFNDRPWLDFNMFQSGHRRYGQRMGNKHYPIPDGTEEDSWMYVDSA
WQHRPLKPVLDGEPSYEGIPQGLHDGSEPRWTALDVRRYAYWSVFAGSCGHTYGNNSIMQ
FARPGVTGAYFADGDSHPWYRALDDPGYNQMKYLRHLMLSLPYFDRIPDQTAVRNNGVRY
DRLLATRGSDYLLVYNHTGRDMTVDLTKISGGEKDVWWMDPTDGRLTYLGRHPSRVTTFR
YHASPSGVPDGVLIAIDASKSYIGRTQTSITSAPAADGERDLTE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	29	482	9.3e-155	0.9805825242718447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	3.81e-136	36	401	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	2.82e-26	407	495	1	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37166.1	1.16e-211	4	503	6	467
QUT76569.1	1.67e-211	4	513	5	482
QUT77834.1	6.08e-211	21	505	29	478
ABR40296.1	4.65e-209	1	513	1	483
QQY40475.1	4.65e-209	1	513	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	8.96e-209	25	503	12	452	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	8.45e-200	25	513	25	478	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	9.32e-199	25	503	12	452	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000419	0.998768	0.000223	0.000211	0.000175	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004462_00235.