CAZyme Information: MGYG000004462_00529

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004462_00529
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		35255.14	10.0993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004462	2469543	MAG	Israel	Asia

• Gene Location: Start: 111741; End: 112652 Strand: +

Full Sequence      

MLRHLLMIGFFAVSSCLSAQMKWNQAYQQYINQYKDLAIEQMLKYHIPASITLAQGVFES
GAGKSSLARKGNNHFGIKCHGWRGATVYYDDDARNECFRAYRNAYESYEDHSRFLAGSQR
YSSLFRLSITDYKGWARGLKAAGYATNPHYADRLIELIQLYRLYEYDRAKGYDKFFARRS
KDNAVNGQALHEIFQFNDNYYLKARSGDTFKSLAKEVGISYRSLARYNERDKRDVLSEGD
IVYLKKKRTKAPKSYKGRVHVVRAGESMYSISQLYGIQLKRLYKLNHLPPYYQIKVGDGL
RLR

Enzyme Prediction     

No EC number prediction in MGYG000004462_00529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	36	163	2.5e-32	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	9.25e-38	28	167	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.35e-35	28	172	44	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	5.40e-31	20	173	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.62e-24	35	111	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.70e-21	47	159	168	291	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81211.1	1.28e-149	1	303	1	303
ADE83099.1	3.65e-149	1	303	1	303
BCS86660.1	7.08e-141	19	302	2	287
VEH15664.1	1.55e-139	6	302	8	305
ALO49150.1	2.12e-139	17	302	17	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	8.53e-12	47	158	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.01e-11	47	158	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	6.69e-11	47	158	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	5.55e-08	28	167	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	7.22e-08	47	159	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.06e-15	44	167	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	7.18e-13	49	286	202	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	1.61e-10	28	159	161	303	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	1.44e-08	47	159	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	1.44e-08	47	159	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004834	0.456073	0.538435	0.000237	0.000195	0.000202

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004462_00529.