CAZyme Information: MGYG000004464_00210

Basic Information

• Species: Barnesiella sp900542255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900542255
• CAZyme ID: MGYG000004464_00210
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000004464_2|CGC1	73916.76	4.8814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004464	2487387	MAG	Israel	Asia

• Gene Location: Start: 96412; End: 98385 Strand: +

Full Sequence      

MLFITTLAAAMVAGSLTGIRAAEYELTSPDGRLQMNVTTAPSLSYAISYDGNAVVNTSPI
ALSLQSGEVWNGTSNLLSVDKKEHNGKVYPLFGKNKEIADCYNELTLSFDGGYAVCFRLY
NEGAAYRFLGERAPADSLVIADETAVFDFADDPGVILPETNNYTSWELSHKLYDGVSDIK
EGVYGITPMLFDNKAQQYKVVVAEADLHDYPGLYLRKTDGKMQGHWAAYPKRIEMGSWGN
FITVVKEREPYIARTAGDHAFPWRIVIVTDDDRTLLNNEIIYLLAKPQQIADTDWIRPGK
ATWEWWHCHILEDAPFDDSNLSTELYKYYIDFAAENGIEYLLVDAGWSNVFNHADLNKNV
DIKEIIRYGKEKNVGVWLWTVAATLFQNKHVYLDSIAAWGAAGVKIDFFDRDDADVMPEY
EDLARACAERHLMVDFHGCSKPTGLHRAYPNILTYEAMRGAECAKWDTTSNPVYQLQFIF
TRMLGGGIDYTPGSMRNVTREKFKPVDPGLPSTLGTRCHDLALYLLIESPFAMLADSPDA
YRKYPDVLKFLSAVPTVWDKTVPLLAKVGEYAVVARQSGEKWYVGGINDWTRRNVVFDLS
FLPQGTEYEVEIFKDVKKSDTDASRYKREVKRYAAGETISMEMAQGGGFVMVFTPIK

Enzyme Prediction     

No EC number prediction in MGYG000004464_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	653	9.6e-181	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.98e-103	292	555	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.12e-53	28	287	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.51e-36	558	654	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR61517.1	0.0	24	657	27	662
QUT86186.1	0.0	24	657	27	662
AII66841.1	0.0	24	657	27	662
QJR53684.1	0.0	24	657	27	662
ALA72672.1	0.0	24	657	27	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.88e-135	28	651	6	638	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	3.15e-134	28	651	20	652	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQ4_A	6.64e-65	28	653	5	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	6.64e-65	28	653	5	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.76e-64	28	653	5	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	8.68e-136	23	651	22	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	3.05e-58	27	652	44	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	2.54e-53	19	657	18	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.998986	0.000161	0.000188	0.000165	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004464_00210.