CAZyme Information: MGYG000004464_01522

Basic Information

• Species: Barnesiella sp900542255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900542255
• CAZyme ID: MGYG000004464_01522
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000004464_22|CGC1	46592.84	5.8412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004464	2487387	MAG	Israel	Asia

• Gene Location: Start: 26159; End: 27376 Strand: +

Full Sequence      

MRQLSQIAVSFLTASLFLSCPVALTAQTDASESWAVRMVESEMARNPEAWQLDFQPKLKW
DYCHGLELRAFLYVAEKYNRTDIRDYAISYADTMVNADGTIKKYKLTDYSLDRINSGKYL
FDVYDLTGEERYKKALDLLRSQFENQPRNEDGGFWHKKVYPHQVWLDGIYMGSPFLAEYA
SRYESDPLRSADYAEVIRQIVMAAHHTYDYESRLYKHACDVSRQMFWCDPVTGQSKHCWG
RALGWYAMAIVDNLEFIPADFEGRKQVVDILLHIAAQLERYADPETGLWYQVMDRSGEPG
NYLESSASCMFAYALYKGVRLGVLPEKYIAVADKAWQGILDRFIKVDEKGQVHITEVCAV
AGLGGKEKRSGDYDYYIHEKKRDNDAKAVGPFILTALEVERLQGK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	401	2e-113	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.10e-109	34	403	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.86e-93	54	402	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA07820.1	2.96e-181	11	403	9	398
AAO79213.1	2.96e-181	11	403	9	398
QMW86461.1	2.96e-181	11	403	9	398
QUT69788.1	2.96e-181	11	403	9	398
ALJ43643.1	2.96e-181	11	403	9	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.94e-97	60	402	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.90e-72	53	402	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.05e-71	53	402	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.21e-10	239	378	230	356	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.82e-10	60	340	66	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.68e-71	53	402	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.14e-36	171	398	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.14e-36	171	398	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	4.84e-08	165	339	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000833	0.480577	0.517649	0.000532	0.000211	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004464_01522.