CAZyme Information: MGYG000004465_00457

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004465_00457
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000004465_11|CGC1	44225.71	4.8576

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004465	2247261	MAG	Israel	Asia

• Gene Location: Start: 15091; End: 16278 Strand: +

Full Sequence      

MFVVNWNRSAAAFLTAVLLSVFQAGAQQAIWSTRAVTSPEVHPDGRVTFRLFAPKAVEVW
VEGDFQGNYRAELREGEDGVWEHTTPPLRSELYSYTFIVDGLRVLDMSNVFIKRDVSSLT
NYFIVEGNPGDLYSVQDVPHGTVSKVWYDSPALGTVRRMTVYTPAGYDNGKGRYPVLYLL
HGMGGDEEAWSDLGRAAEILDNLIAAGRCLPMIVVMPNGHVFNDAAPGQAPGGLEQPDFN
RSGEAACTMEESFPDIVNYVEQHYRVRKDKASRAIAGLSMGGGHAMNISRMYPDMFDYVG
LFSAAVMPREKRTEGGSAAGAYSDIESSLAEQFSREPALYWIGIGKEDFLYGYNEGYRAF
LDSHDWPYTYYENGGGHIWRNWRIYLTEFLPLLFR

Enzyme Prediction     

No EC number prediction in MGYG000004465_00457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	150	391	5e-55	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11294	E_set_Esterase_like_N	1.61e-31	45	125	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	1.79e-31	84	395	14	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0627	FrmB	2.81e-19	160	393	38	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	8.12e-19	150	393	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	1.45e-11	45	106	1	59	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH98968.1	4.63e-158	12	395	5	397
QUT21362.1	4.63e-158	12	395	5	397
ABR44406.1	4.63e-158	26	395	19	397
QRO15451.1	4.63e-158	26	395	19	397
AST55403.1	4.63e-158	12	395	5	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	2.66e-102	25	395	11	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	3.68e-51	39	395	40	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	6.78e-46	39	395	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	6.95e-46	39	395	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	2.43e-43	39	395	42	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.14e-44	39	395	329	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.61e-34	40	395	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	2.37e-30	138	392	46	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	5.66e-29	39	310	395	661	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P35866	1.58e-06	149	388	170	413	Uncharacterized protein Cgl0967/cg1104 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl0967 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.069589	0.900382	0.027924	0.001446	0.000316	0.000309

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004465_00457.