CAZyme Information: MGYG000004465_01862

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004465_01862
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41207.07	6.3806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004465	2247261	MAG	Israel	Asia

• Gene Location: Start: 2821; End: 3924 Strand: -

Full Sequence      

MHVAPGTVPAMPEGKTDNTHTNAKGARKVASLICGEIAKEIPEIARHFVHYDIVVAQDGT
GDYFTVQEAIDACPDYSHEQITTILIRNGVYNEMVTIPHNKFRLHIIGESADSTVISCGK
YARQMWPGRDFNVGTSGSAGFYIHSSYITIENLTILNPAGEGKEIGQAVALFTNGDRLFF
KNCRIIANQDTIYTYGRWNKEGGPCRNYFLNCYIEGTTDFIFGPSIAYFENCTIHSKKNS
YITAASTPEGQKYGYVFHNCRLTAAEGVDKVYLGRPWRPYANTVFIDCELGSHIHPDGWK
SWPRELYPSGEGTAFYAEYGNYGPGASPETRVKWSVQLTRKQAEEYTFEKVMHQDTDTHA
WNPEDNR

Enzyme Prediction     

No EC number prediction in MGYG000004465_01862.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	52	353	2.8e-101	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.80e-80	52	347	1	290	Pectinesterase.
COG4677	PemB	9.05e-67	51	347	81	397	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	2.89e-66	55	357	9	301	pectinesterase
PLN02432	PLN02432	2.02e-60	53	343	13	277	putative pectinesterase
PLN02708	PLN02708	1.09e-59	52	347	242	538	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW89209.1	5.72e-118	1	363	187	529
AAO79215.1	5.72e-118	1	363	187	529
ALJ43641.1	1.56e-117	1	363	221	563
QQA07818.1	1.56e-117	1	363	221	563
BCA48647.1	1.56e-117	1	363	221	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.40e-45	52	334	8	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.44e-44	54	334	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.77e-36	51	352	4	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	1.05e-32	53	331	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.04e-32	53	331	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.79e-49	55	357	9	301	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q1PEC0	8.53e-49	52	356	215	511	Probable pectinesterase/pectinesterase inhibitor 42 OS=Arabidopsis thaliana OX=3702 GN=PME42 PE=2 SV=1
Q84JX1	2.30e-48	52	356	215	511	Probable pectinesterase/pectinesterase inhibitor 19 OS=Arabidopsis thaliana OX=3702 GN=PME19 PE=2 SV=1
Q3EAY9	5.41e-48	52	356	188	484	Probable pectinesterase 30 OS=Arabidopsis thaliana OX=3702 GN=PME30 PE=2 SV=1
Q43062	6.07e-47	49	347	205	498	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004465_01862.