CAZyme Information: MGYG000004468_00194

Basic Information

• Species: Alistipes_A sp900539755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900539755
• CAZyme ID: MGYG000004468_00194
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000004468_1|CGC2	51069.24	5.8087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004468	2418771	MAG	Israel	Asia

• Gene Location: Start: 235780; End: 237162 Strand: -

Full Sequence      

MNKKNSKLTLTRRDFLKSSAVGALGAMVAPSLLTTGCSSSSDDTKLYPDALIPEMLPQAP
DGRPLKAGLIGCGGRGTGAAVNFRDAGNGLTVTMLADIFPDKMAQCRKTLKEYNIEVPDE
NCFLGFDAYKKVIDSDVDVVLLCTPPVFRAREFAYAVEKGKHVFLEKPCAIDPVGARSIL
RSAKLAEQKGLSVISGTIRRSQRDCVETFRRVADGAIGDIVSAQVIRNGGTLWHKDRQPG
WSDMEYVMRNWPNFCCISGDLLTEQFIHEIDMMSWFLGDRKPLRAIGYGGRQRRVTGDVY
DFFSIQYVYDNEIRTNCASRQIDGCDNELYVMVYGTKGSTNCFDTIYNLDGSIAWKYPAP
KPDDPDQTWAVKNPYVQEHIRLVTAIRNNEPINDVETHVQSVMMAIMGRMAAYTGKSVTW
DEIMASDLDLSLENYEFGPFPGGVNEIVPKPGKDPDEKKA

Enzyme Prediction     

No EC number prediction in MGYG000004468_00194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	65	224	2.6e-16	0.38847117794486213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.02e-39	62	422	1	342	Predicted dehydrogenase [General function prediction only].
TIGR04380	myo_inos_iolG	4.84e-15	64	279	1	187	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam01408	GFO_IDH_MocA	1.61e-10	65	196	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	5.56e-05	134	221	62	146	putative oxidoreductase; Provisional
pfam02894	GFO_IDH_MocA_C	1.47e-04	212	419	4	203	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG54020.1	6.71e-302	1	460	1	458
QGA24596.1	5.14e-225	10	452	7	446
QGY48065.1	5.57e-184	21	454	1	424
BBD44694.1	2.66e-177	6	454	3	450
QGY48130.1	1.00e-176	27	452	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A02_A	2.28e-09	110	362	45	289	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
3EC7_A	5.88e-09	62	279	21	208	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4N54_A	1.36e-08	63	278	13	205	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	1.37e-08	63	278	16	208	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4HKT_A	5.12e-07	135	339	62	248	Crystalstructure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9N564	1.64e-08	65	279	3	187	Inositol 2-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=iolG PE=3 SV=1
B5F3F4	1.64e-08	65	279	3	187	Inositol 2-dehydrogenase OS=Salmonella agona (strain SL483) OX=454166 GN=iolG PE=3 SV=1
Q8ZK57	1.64e-08	65	279	3	187	Inositol 2-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iolG PE=1 SV=1
P0C863	2.48e-08	65	171	54	159	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	2.48e-08	65	171	54	159	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.000628	0.999371	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004468_00194.