CAZyme Information: MGYG000004468_00818

Basic Information

• Species: Alistipes_A sp900539755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900539755
• CAZyme ID: MGYG000004468_00818
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43879.74	7.825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004468	2418771	MAG	Israel	Asia

• Gene Location: Start: 42944; End: 44098 Strand: -

Full Sequence      

MRYYLIAGEASGDLHGSNLIHGIRKADPEAVFRFWGGDKMAEAGGAENLAMHYKNASFMG
FTEVLLHLRTIFRQIDECKADITASQPDVLILIDYAGFNLRIARFAKEVGIPTYYYIAPK
VWAWKESRIKKIRKYVDRLFVIFPFEIEYFRSKGIEPIYEGNPLIDAIDQRRSALLPREE
FIAKNHLDERPIIALLAGSRRSEIGYNLPFMVELSKLYPQYQFVVAGVSWLDRSIYTPYL
QGSDVRYICDETYELLAVSEAAVVTSGTATLETALLGVPQIVCYRRDWASMLIGKAFLKI
PYVSLVNLVLHREAVRELLQHHMNMKNATAELEAILPGGSKHERMMADYAQLQELIGHKH
PSDKFAARMVEFLRKDRQNCTTQS

Enzyme Prediction     

No EC number prediction in MGYG000004468_00818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	1.6e-112	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.47e-110	1	370	2	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.01e-108	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.76e-84	4	335	2	333	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.51e-68	5	372	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.36e-57	57	373	49	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG53033.1	1.84e-242	1	376	1	376
QGA24435.1	2.71e-204	1	378	1	378
AFL77950.1	2.32e-170	1	370	1	370
BBL11605.1	2.53e-167	1	374	1	374
BBL08813.1	2.53e-167	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.07e-35	5	370	11	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.07e-35	5	370	11	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	6.24e-73	2	377	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	8.46e-70	2	375	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.80e-68	5	375	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	7.82e-67	2	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	1.70e-65	2	357	8	364	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004468_00818.