CAZyme Information: MGYG000004471_01073

Basic Information

• Species: UBA1394 sp900554975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900554975
• CAZyme ID: MGYG000004471_01073
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	MGYG000004471_14|CGC1	45945.32	3.8923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004471	1997651	MAG	Israel	Asia

• Gene Location: Start: 12984; End: 14219 Strand: -

Full Sequence      

MNKKIKVMISFITAFSLVLSCFVFSSAEESSNDTVAIMPLGDSITDGFTSEGLGAYREKL
YNLLIQNGYENKFDFVGPNWGGNFADPQHAGFSGYSIDNIPQDKSISGQRTGLYSFIDWL
METYPADIVMLQIGTNDILSLYDLDNAGTRLELLIDKIMSYLPDDGMLFLATIPCMDATN
TLYINQYYFTVDSMDECVNTYNNTIKEIVRKRQANGENIRLADINSVLTKDDLYDGVHPK
KTGYDKMGEYWFNTLDSYWKGNQEETTEPTLIPTEPVTEPSSEPTQPATEITDVTETTAE
TTPATETTTEVTDITEITTETDVTVTTVTSETTAITEITQPVTETTGTITVIPGDINNDE
NISLTDLTILNKYLIKKYEMNTDEYIRADISQDGYINIFDSILIRRTVLGI

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	36	255	1.8e-44	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01833	XynB_like	2.47e-40	37	255	3	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	7.56e-15	40	246	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd14256	Dockerin_I	4.43e-11	353	409	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00657	Lipase_GDSL	7.47e-11	37	251	1	224	GDSL-like Lipase/Acylhydrolase.
cd00229	SGNH_hydrolase	1.62e-09	40	253	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV68498.1	8.41e-42	29	255	132	326
ACL76728.1	6.05e-36	32	255	114	305
AEY65113.1	1.63e-35	32	255	114	305
QHT57909.1	1.57e-33	27	257	29	230
QIQ01917.1	1.36e-32	31	257	35	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.99e-19	31	256	2	197	ChainA, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RLB8	1.35e-32	29	270	38	276	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
P15329	2.03e-06	97	256	1	139	Putative endoglucanase X (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001227	0.365219	0.632901	0.000238	0.000220	0.000185

TMHMM  Annotations     

start	end
7	26