CAZyme Information: MGYG000004472_00628

Basic Information

• Species: QALR01 sp900553085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900553085
• CAZyme ID: MGYG000004472_00628
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000004472_3|CGC1	62109.21	4.4912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004472	2148581	MAG	Israel	Asia

• Gene Location: Start: 85812; End: 87464 Strand: +

Full Sequence      

MIPIVAYWDDVDMVPWALPQVYDYMEGWDAASVVSPLQQEVYNRRRYLTCYGKEQKTSFG
TIYIDRGGGTPDSYTGLATVSDYMTVLGEGATATFHFTIEQAGTYDIAVRLAFPFWDKNA
LNVSVDGSSKTFSESRLWWPYWRRTCWLSLASGRSLSAGNHTLVISGGVPGVQFYGFRVC
SNFSEEPSAGEAAFTLSPRQFLDVNGDPATPDKGFKLTCEMLRRKPDSALVWYEDFRDDT
PLPDSYWTTLSGEWSVWRESYTTENRPYSLLEGSGKLAWKYDGFSDLHIRARVGFPQNGG
GRAGVFLGNLFCCLNYDTQRVELYQGSTLLGSYSTSFSKTPDAQLHSDPTVYTIEMRKRG
NKVRVYSGSSYTLRFTATVSATSGYAGIQADNEIVCDLLRAGDAWAYEPYECFDVVYPDG
VRTSFGRIARSGVTWDEEFQIFSVNSDVDEGSTRSEDISLDYDFFHSHLLEISCGNDYTA
KVIPRDINVWTARLFLGDADGFSILYYQDVDSLVYWANEAAYRWGLRGIAIWSLGQEDMR
LWEVMPKQIE

Enzyme Prediction     

No EC number prediction in MGYG000004472_00628.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02795	CBM6-CBM35-CBM36_like	4.59e-09	67	179	11	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
COG3858	YaaH	6.85e-04	472	548	346	421	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd04086	CBM35_mannanase-like	0.005	94	168	39	107	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB62530.1	0.0	1	550	275	824
AXB69977.1	0.0	1	550	275	824
AUV57934.1	0.0	1	550	275	824
AEV70157.1	7.96e-308	2	549	275	822
ANX01803.1	2.27e-307	2	549	275	822

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004472_00628.