CAZyme Information: MGYG000004472_02017

Basic Information

• Species: QALR01 sp900553085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900553085
• CAZyme ID: MGYG000004472_02017
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41495.16	4.6672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004472	2148581	MAG	Israel	Asia

• Gene Location: Start: 12795; End: 13889 Strand: +

Full Sequence      

MNETKKRCSFARICEALLLLFCTAALIFSTGSGYVKKLIESYRYPREFREYVEEYAALYG
VEANIVYAIIKAESGFCRTAVSRSGAIGLMQVIPDTYLLDIRDNIGLDEPSSVLFQAKEN
IQSGTYYFAKWYGHFGSYVEALAAYNAGVGNVQKWLADESISTTSGLIIDKIPFEETKNY
INRVLSYKEKYDELYGKEELPQGDTVSERLCYEWALKYGEQYKIDPRFVMAVVKAESSFR
PDCVSVSGAVGMMQIMKPTYEGDIKANLKLEEEFDALFDAEFNVKCGTYYLHWLDERLDG
YEQLAAAYNGGIGNVRKWLADPEYSSDGKTLIVDNIPLDQTKRYVKKVMTFYEEYCLRYP
DVTG

Enzyme Prediction     

No EC number prediction in MGYG000004472_02017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	64	191	1.3e-25	0.7925925925925926
GH23	223	355	5.9e-25	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.09e-48	217	353	10	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.05e-46	45	190	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.24e-41	43	194	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13401	Slt70-like	1.66e-38	217	355	12	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.96e-31	66	187	4	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS52076.1	1.72e-31	213	359	37	182
QNU68364.1	2.03e-31	26	199	22	192
CEI72025.1	2.41e-31	18	198	6	183
QEK21465.1	9.22e-31	33	198	22	184
QQQ87095.1	1.80e-30	33	198	22	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.09e-18	36	201	404	565	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.10e-18	36	201	408	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.12e-18	36	201	414	575	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.13e-18	36	201	418	579	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.15e-18	36	201	424	585	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.72e-15	52	186	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.85e-14	43	218	475	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	1.12e-13	44	221	1418	1571	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.12e-13	44	221	1418	1571	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P0AGC3	4.49e-13	43	218	475	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.901540	0.089482	0.001443	0.000325	0.000186	0.007051

TMHMM  Annotations     

start	end
13	35