CAZyme Information: MGYG000004473_00779

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000004473_00779
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000004473_7|CGC1	36765.39	9.195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004473	2142125	MAG	Israel	Asia

• Gene Location: Start: 68140; End: 69132 Strand: -

Full Sequence      

MDMKNILTINFGGIGDEIFFLPTLISLKKAFPNSKITLALEPRSKSVKDLTDIIDDLMLI
DVKGKNKYTQMLKLLWQARRGKFDLVVSSGGNKLISILLFLMGIKERCGYDTGALSRILL
THPMKLNKNQYACKMYHDLIREVTDINTELPEVNIERKEKIQNSVLIHPGVSKLSVQKGC
IKTVPAETWAKTIDLLVAEGKKVMLVGGPDDKECIETILNTVRTQNFENLYGTTKSLKDL
AVLISSAEKFLCSDSAPLHVAVALHTKTYVIFGPTDVNALIPKTDSVVPIMANDKCELKP
CLWARRQTTCEKLSCLKITASQIAETVLKK

Enzyme Prediction     

No EC number prediction in MGYG000004473_00779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	73	307	2.2e-33	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.46e-46	3	300	1	305	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.65e-44	5	325	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.85e-17	4	294	6	310	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	9.98e-17	75	313	4	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.22e-11	5	326	1	328	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	3.44e-160	5	328	2	327
AFY67702.1	8.80e-51	12	292	9	299
ARV62225.1	1.60e-47	12	290	9	297
BAU12214.1	3.33e-47	12	290	9	299
ACK71073.1	1.78e-46	12	282	9	289

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	7.86e-14	15	298	5	302	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	2.96e-12	15	294	5	298	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004473_00779.