CAZyme Information: MGYG000004474_01140

Basic Information

• Species: Sodaliphilus sp004557565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp004557565
• CAZyme ID: MGYG000004474_01140
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	MGYG000004474_23|CGC1	95094.15	6.4743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004474	2861939	MAG	Israel	Asia

• Gene Location: Start: 25469; End: 27997 Strand: +

Full Sequence      

MKRLILLLSFCVAFLSMFADSWVRINQLGYIPKTSKVAVYLSEEATEVSSFQLVDVFTGK
VVYTSKAVKPMGALGGMKATYRLNFSDFIRQGTYRIVVNGCESPIFPINGHVYDGTADFV
LNYMRQQRCGFNPFLRDSCHQKDAFIRYHATKEGQHIDVRGGWHDAADLLQYTTTSANAI
YQMLFAYQQNPDAFTDSYQANGLPGANGIPDIVDEIYWGLDWLDRMNPEKGELYNQIADD
RDHIGQKLPQTDPSDYGRGPNNGRPVYFIDGKPQQRGTYMNATMGAASTAGKFASDFALG
AEVLKPFYPQFSQKISSKAADALQVGIDKPGNTQTVSVVSPYIYEEDNWVDDMELGSVEL
FRMTGDGKYLTKAVEYGRREPVTPWMGADSARHYQWYPFMNMGHYQIAAHTTDARLKAEF
LRNMRAGIARTYERGQAHPFLWGIPGIWCSNNLTTAMLTQCILYRTLSGDDSFEEMEGAL
RDWLFGCNPWGTSMIVELPKGGTYPRATHSNWVFQNLGHPVGGLVDGPVYSTIFSSLRGV
NITDDMPHVTANAYLRFQPGDVVYHDNTHDYSTNEPTMDGTASLTFPLSYYQKEGRAQAD
AASADKNVYDEGGIKQGDPSKKNICLVFTSHDKTDGANYIISTLKKRNVKGAFFFTGHFF
ESFPDIVKRIQAGGHYVGSHSYGHLQYAAWENRDSLLVTKDEFTTDMLKGYEVMSKFGVT
KDHAPYFIPPYEYYNSTISSWAKELGLQIVNFTPGSASNEDYTWHGMPMEAEKYRSSQWL
YDNMMKWEKKHTLNGHFLMIHLGTDDARTDKFYLKLDKIITTLQKKGYNFVSLEDMIGLN
LK

Enzyme Prediction     

No EC number prediction in MGYG000004474_01140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	113	586	1.3e-71	0.9880382775119617
CE4	618	751	1.1e-17	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	2.02e-55	121	588	7	374	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	4.14e-26	640	824	19	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
pfam02927	CelD_N	5.76e-26	21	103	1	83	Cellulase N-terminal ig-like domain.
cd10948	CE4_BsPdaA_like	2.88e-23	593	833	11	223	Catalytic NodB homology domain of Bacillus subtilis polysaccharide deacetylase PdaA, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis pdaA gene encoding polysaccharide deacetylase BsPdaA, which is a member of the carbohydrate esterase 4 (CE4) superfamily. BsPdaA deacetylates peptidoglycan N-acetylmuramic acid (MurNAc) residues to facilitate the formation of muramic delta-lactam, which is required for recognition of germination lytic enzymes. BsPdaA deficiency leads to the absence of muramic delta-lactam residues in the spore cortex. Like other CE4 esterases, BsPdaA consists of a single catalytic NodB homology domain that appears to adopt a deformed (beta/alpha)8 barrel fold with a putative substrate binding groove harboring the majority of the conserved residues. It utilizes a general acid/base catalytic mechanism involving a tetrahedral transition intermediate, where a water molecule functions as the nucleophile tightly associated to the zinc cofactor.
COG0726	CDA1	4.92e-23	569	837	12	257	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66756.1	0.0	19	839	21	836
QUT98069.1	0.0	19	839	21	836
QUT35459.1	0.0	19	839	21	836
QPH59586.1	0.0	19	839	21	836
QBJ19309.1	0.0	19	839	21	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	5.21e-39	23	591	18	556	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	8.55e-30	31	612	2	553	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	1.98e-26	31	612	2	553	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
6DHT_A	6.92e-17	16	584	11	557	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
5O6Y_A	2.23e-16	617	836	16	207	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14090	2.66e-25	23	598	341	914	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P23658	1.12e-22	23	589	4	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
A7LXT3	1.73e-16	11	584	20	571	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
Q05156	3.06e-16	23	595	185	746	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
Q04729	3.18e-15	591	837	34	254	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003301	0.994682	0.001249	0.000240	0.000233	0.000258

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004474_01140.