CAZyme Information: MGYG000004478_00523

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA11549
• CAZyme ID: MGYG000004478_00523
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		42916.81	8.6792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004478	2186477	MAG	Israel	Asia

• Gene Location: Start: 42842; End: 44017 Strand: +

Full Sequence      

MTQNDELFIYLVAGEPSGDLLASRLMRALREKTNGKVRFAGVGGETMIENGFESLFDSSE
LAVMGLAEVIPSIPRILKRIRQTVEDIAAQKPDVVITVDSWSFSARVNKGLKALHTGIPQ
IHYVAPQVWAWKKGRAKTCGRYIDRLMALLPYEAKYFEPYGLKVDFVGHPVVEGGASKGN
GKAFRKQIGVSDQVKLLCVLPGSRRSETKYLLPVFKETVAALAKKYPDMHIVIPTVVTVE
RTVRTAVADWVLPVHVVTGEANRYDAFAACDAALAASGTVALELAMAKVPYTIAYKMNPI
SSFLARKLVSGRFANLVNILPDREIVKEYLLEDCTVANLTAEIEKLLDDQVYRETEVTQA
FDVLKTLGADDTVTPSQKAAAVVLETVGKKN

Enzyme Prediction     

No EC number prediction in MGYG000004478_00523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	363	1.2e-118	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.66e-132	9	390	4	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.61e-132	9	389	4	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.38e-97	9	382	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.29e-77	9	349	8	347	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.81e-52	11	339	5	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE51288.1	8.12e-129	7	385	1	379
QIM10250.1	1.04e-128	4	390	2	387
ARJ65449.1	8.26e-125	7	390	6	389
CUW40282.1	1.34e-123	7	390	6	389
AUN29831.1	1.61e-122	9	387	6	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.44e-62	1	347	1	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.05e-61	1	347	1	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	1.62e-129	7	385	1	379	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.51e-122	7	390	4	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	1.32e-91	9	385	31	403	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	2.70e-91	9	349	6	343	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	3.31e-81	9	385	13	387	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004478_00523.