CAZyme Information: MGYG000004479_00055

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_00055
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000004479_1|CGC3	43311.33	8.7039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 71993; End: 73144 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMKALLQHDPEAEFRFFGGDLMAGVGGVLVKHYKDMAYMGFI
PVLLHLRTIFRNMDYCKKNIVCWQPDVLILVDYPGFNLKIAEYIKAHTRIPIFYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVEFFRKHSYPIHYVGNPCVDAVDCFQQTYTEDFSH
FTARNNLGGKPIIALLAGSRKQEIKDNLSRMIEASRAFPEYQFVVAGAPGIAPEFYRTYM
GKDAEIVFGQTYDLLSHATAALVTSGTATLETALFRVPQVVCYYTAAGKLVSFLRRHILK
VKYISLVNLIAGREVVTELVADGMTVENVKTELARIVPGGDGRKAMQKDYEILAGILGEA
GASDRAASQMVELLRKKYHRSSI

Enzyme Prediction     

No EC number prediction in MGYG000004479_00055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	353	3.9e-107	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.35e-99	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.23e-96	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.55e-72	4	368	2	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.70e-60	5	373	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.25e-45	1	328	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	4.73e-214	1	377	1	377
ADY36062.1	3.63e-210	1	374	1	374
QUT77942.1	1.43e-194	1	376	1	378
QRQ48683.1	3.87e-193	1	378	1	380
QUT45721.1	6.37e-192	1	378	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.61e-37	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.06e-36	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.12e-66	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	5.06e-64	6	374	10	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	7.71e-64	6	374	15	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	2.64e-60	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	3.11e-58	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004479_00055.