CAZyme Information: MGYG000004479_02171

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_02171
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000004479_26|CGC2	59620.1	5.5647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 22877; End: 24460 Strand: -

Full Sequence      

MGMNKLVFCLGFSLYAALGCAQEEQKLVFDFASPRQTIHSFGASDCWRVQYIGKNWPLEK
RNQIADLLFSSEFDSWGNPKGIGLSMWRFNIGSGSHEAGDNGGVASLWRRTECFLDKEGN
WDWDKQEGQRWMLQAARERGVRYSLGFSITAPYFMTKNGMARASEKTPYANIREDQFDDY
AAFLAEVSTHLKLDYLSPINEPQWEWVGSGQEGMQATNMECSRLIHLLDKELQQRNSVTK
VVFGEAADIRYLYRSATDKPERDNQLEEIFSKEGSYSIYGLSSVAPVVSGHSYWSTWPVD
TLVQTRKELAEELRKQLPSDYTYWQTEYCPMEQNPDNPRGGGGRDLSMNTALYVARVIHH
DLTVANASSWQWWTAFSEWDYKDGLIFIDDGTLANGASRGDEKMIETCKQDGVFRTSKLL
WTLGNYSFFIRPGMVRLSSVTNTDNAAGVMASAYADNSLKRIVVVLVNSSRKDKMIDLSF
QSLPAGYCVQKYKLYETSARSDLQYKGIVGSQLLIPARSVVTLVGAE

Enzyme Prediction     

No EC number prediction in MGYG000004479_02171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	29	524	4.9e-180	0.9896694214876033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.03e-163	24	387	1	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	4.35e-08	30	524	39	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW99529.1	1.74e-155	10	523	12	520
QUT88592.1	1.08e-152	25	525	37	537
ALJ60402.1	2.16e-152	25	525	37	537
QDO68591.1	4.33e-152	25	525	37	537
SCD20877.1	1.59e-147	23	525	34	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	2.25e-116	23	524	4	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	2.70e-11	36	524	34	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	1.46e-10	27	469	5	387	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	2.08e-10	22	469	7	394	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	2.18e-11	7	469	8	411	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.999082	0.000229	0.000152	0.000138	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004479_02171.