CAZyme Information: MGYG000004479_02346

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_02346
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000004479_30|CGC2	91343.42	6.46

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 34142; End: 36580 Strand: -

Full Sequence      

MKNRLLILMSGVVAMGVVSCTKPAYQQPDAPIQEVPFTQVHINDGFWSPRIETNRTVSIP
SAFKECEKNGRFDNFAIAGGLKKGEHRGDFSFDDTDPYKVIEGASYSLAVKYDPKLDHYL
DSVINIIAAAQEPDGYLTTCVTNKCYRLSGWWGRSKWEKLNSHELYNSGHMYEAAIAHYR
ATGKRTFLDVAIKNADLVCKVFGPGEGQKHVPSGHPIIEMALCKLYKVTGDEKYLNMAKY
FVEETGRGTDGHKLSEYSQDHKPILQQDEIVGHAVRAGYLYSGVADVAALTKDTAYFHAL
TRLWDNLVGKKLYITGGMGSRAQGEGFGPNYELQNHTAYCETCAAIANVYWNYRMFLATG
DSKYMDVLERALYNGVISGVSLSGDKFFYDNPLESMGEHDRQPWFGCACCPGNVTRFMAS
VSNYVYAIQQNDIYVNLYIQGKAEMKTADNKVTLEQTTQYPWDGKIAIKVTPEKEGKFAI
RLRIPSWAKSAPVASDLYAYTDAAKKYTLKVNGSDVKGMEGDGYETLVRTWKPGDVIELD
LPMDVRRITANDKVEVDRGMVALERGPIMFCLEGKDQPDSIVFNKFIPRDAKIKATYDAN
LLKGVMVLSGTAKELGKDGSVKDVPFRAIPYSTWDNRGADQMEVWIPETKEYATPTPEPT
IASKAQTFTIQAAIQKDAPESAAVMSYAWGVNDQWEPKRSSDTSKPYFYWWLKDGTLESL
AYEFDQPYTVSKVEVYWLDFDHYDGNFRVPQSWKLYYKNGNTWKEVETNDQYGVEKDKYN
VVNFKPVKTTGLKISAQLQKGASGGIIEWKVE

Enzyme Prediction     

No EC number prediction in MGYG000004479_02346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	40	571	1.3e-212	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	39	571	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.08e-178	35	650	12	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04434	LanC_like	6.03e-04	103	234	104	239	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38942.1	0.0	1	811	1	810
ABR38820.1	0.0	1	811	1	810
QUT60192.1	0.0	1	811	1	810
QEW34697.1	0.0	1	811	1	810
QQY42147.1	0.0	1	811	1	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.55e-221	31	647	6	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	8.91e-157	38	648	14	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.56e-153	38	648	14	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.16e-109	40	647	44	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.19e-101	74	645	56	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.52e-101	74	645	56	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.002483	0.997563	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004479_02346.