CAZyme Information: MGYG000004479_02844

Basic Information

• Species: Phocaeicola mediterraneensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola mediterraneensis
• CAZyme ID: MGYG000004479_02844
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000004479_47|CGC1	97122.78	6.0982

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004479	3712458	MAG	Israel	Asia

• Gene Location: Start: 5587; End: 8151 Strand: +

Full Sequence      

MKMNHYAKCVTAGLLCTFMYGNLSAQETDFDLSSQRSEKQDVQAVPGKKIDHQGLILNPT
PHLLKVNENSICPISQGIKLKDKQQKFAAYLDFLTANKKGIKLTIDFGQKTARKAQVKEV
SGAYSLIISPKEIILTGYDERGVFYGIQTLKQLAESPVSANGTLPCMEINDYPDLPNRGV
VEGFYGTPWSHEVRLSLIDFYGKFKMNTYLYGPKDDPYHSCPNWRLPYPEKEAQHIKELV
DASNRNYVDFVWAIHPGQDIKWNEEDYHNLLQKFNWMYDLGVRHFAIFFDDISGEGTNPL
KQTELLNRLTEEFVKVKGDVSPLTVCPTDYSKLWANPTEKGSLAIYGKTLNPEIKVFWTG
DVVCSDLTPETLDFINSRIKRPAYYWWNYPVTDYIRNFLLQGPVYGLDTSLTAQETCGVI
SNPMEHGEASKLALYGVADYAWNIADYNAIDNWERGLAELVPDATEAYRTFAIHSSDTEN
GYRRDESWETRTFRIADWNDAAANALEEEFKKVESVPARMENGCKNKALLNELRPWLTEF
GKLGTRGKQAIELARIYRSGQDDALFWTKYVQNIMTPEDRKNYEAHKSGTLKLQPFYEHA
MDDMAHGYLKKLSGKVPTDYKGIGSFSSAHTVQTKLMFDNDSTTFYTSGIAQKANDWIGV
DLRDVRDVTEISILQGRNSKDDVDYFDHAVVECSADGQNWKALTGELNQQYIIHWQGAPE
KARYVRLKRLDSKRTNYASVRSFDVNPLRPDNLGFTLEADTLSKAVYAFDNNLSTSYQST
KAIAFGVDKDVKAYTLLMNQLSTPIKCVQVDKKGKVLSETMIETPYARIELADKNVSQIR
LEGKAEIFEIVPIR

Enzyme Prediction     

No EC number prediction in MGYG000004479_02844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	178	472	7.7e-106	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.94e-169	178	471	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.37e-12	79	171	32	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	2.63e-07	638	728	18	111	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG3525	Chb	4.22e-06	57	232	136	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	3.16e-05	638	727	29	126	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	1	853	1	852
ADV43394.1	0.0	6	851	3	847
BCI62100.1	0.0	1	852	1	853
AHF11939.1	0.0	8	854	6	855
BBL05673.1	0.0	1	851	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	2.53e-158	96	570	61	539	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	3.50e-158	96	570	49	527	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	3.61e-158	96	570	50	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	3.61e-158	96	570	50	528	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	3.61e-158	96	570	50	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	3.71e-157	96	570	71	549	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	6.45e-95	1	846	1	874	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.71e-94	1	732	1	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	3.32e-48	127	754	135	803	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	1.43e-33	179	450	63	339	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000643	0.997593	0.001111	0.000200	0.000208	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004479_02844.