CAZyme Information: MGYG000004483_00400

Basic Information

• Species: CAG-873 sp900554715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900554715
• CAZyme ID: MGYG000004483_00400
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197		22402.98	9.3372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004483	2849207	MAG	Israel	Asia

• Gene Location: Start: 11765; End: 12358 Strand: +

Full Sequence      

MSTLDTFLITVAMIAVPSVSMAQFHTITKETPIEAPPAVVNIKEPENVEYTESRELAMTV
KYPDSIQIAFRNAGIVRKSCDEVAAADNLPPLTIQNLIAEIEKNGIKYPKIVLAQAILET
GWFKSPVCRNKHNLFGLTNPRTGKYYEFNHWTESVKAYYTKVQYRYKGGNYLLWLKKIGY
AEDPGYIRAVIRVLRQL

Enzyme Prediction     

No EC number prediction in MGYG000004483_00400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	96	196	4.4e-18	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.79e-15	95	159	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	1.48e-12	102	197	59	182	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.24e-12	102	196	24	138	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.03e-06	113	196	186	305	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	2.76e-04	105	197	171	297	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43688.1	6.70e-129	13	197	1	185
QCD34777.1	5.56e-83	1	197	1	200
ANU62956.1	7.00e-81	4	197	2	198
QQR09706.1	7.00e-81	4	197	2	198
ASB36544.1	7.00e-81	4	197	2	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000528	0.998607	0.000227	0.000227	0.000215	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004483_00400.