CAZyme Information: MGYG000004483_01469

Basic Information

• Species: CAG-873 sp900554715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900554715
• CAZyme ID: MGYG000004483_01469
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		54881.52	5.5438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004483	2849207	MAG	Israel	Asia

• Gene Location: Start: 618; End: 2078 Strand: -

Full Sequence      

MKTTINCFLPYAEPAQVKATVEGLKKSPLVTKIFLLATGENCEAVEGCEVIKTDGLNTSE
TMKKIAGAADAEYILLYTKYNNLVMGYFALDRFVKIAQDSKAGMLYADSYTVVDGKKTNS
PVIDYQFGSLRDDFGFGSVLFFKAADFKKAAAGIDKEYKAAGLYDLRLRLSRIAPIVHIN
EYLYSDITLDNRKSGEKIFDYVDPKNRGVQIEMEEACTAHLKEIGGYLAPKFTPIEFNKG
DFEYEASVIIPVRNRVRTIRDAIKSVLSQKTDFPYNLIIIDNHSTDGTSEAIEEFTSDPR
VIHIIPERDDLGIGGCWNAGVNHEKCGKFAVQLDSDDVYKDENTLAKMVKAFYDQNCAMV
VGTYMLTDIDMNMIPPGVIDHKEWTPENGRNNALRINFLCAPRAFYTPLLREIHVPNTSY
GEDYALGLAFSRHHQIGRVYDVVYLCRRWEDNSDAALDINKMNANNLYKDRIRTWELQAR
CAMNKD

Enzyme Prediction     

No EC number prediction in MGYG000004483_01469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	247	370	2.5e-22	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	5.18e-21	248	363	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	2.28e-20	247	443	1	189	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	6.64e-20	247	370	1	121	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	3.89e-16	247	449	6	198	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04179	DPM_DPG-synthase_like	1.65e-13	248	373	1	125	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73949.1	7.38e-260	1	485	1	485
CUA17042.1	3.48e-258	1	485	1	485
QDO67925.1	6.77e-258	5	485	4	485
QIK60901.1	9.60e-258	1	485	1	485
AKA50499.1	1.41e-257	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	8.29e-08	247	464	16	219	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	9.91e-08	247	366	9	125	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q4UM29	1.78e-07	164	342	195	388	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	5.42e-07	164	342	195	388	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q57287	3.94e-06	247	409	8	163	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004483_01469.