CAZyme Information: MGYG000004484_01355

Basic Information

• Species: UBA2903 sp002349565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA2903; UBA2903 sp002349565
• CAZyme ID: MGYG000004484_01355
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735		84271.8	5.1555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004484	1902889	MAG	Israel	Asia

• Gene Location: Start: 28984; End: 31191 Strand: +

Full Sequence      

MKNYLDESIVEALVTSGYGDPFSVLGIHREGADGDLVVRTFQPQAQNVYVLEYETGKVMA
QMERVHSSGLFQYEFPADWDYFKYRLRIDLWQGESYDTEDAYRFPPVLGDMDIYYMSEGS
HLDEYDRLGAHPIKLDGVDGVAFAVWAPNARRVSVVGTFNEWDGRRHMMRPRGSSGIWEI
FVPHIGEGALYKYELIGPEGNILPLKADPVAFYAEKRPSTASVVYNLDRYEWKTKGWGKK
REAANAMDAPISIYEVHLGSWRRNSDEGMRYLTYREMADELVPYVKDMGYTHVELLPVNE
HPFDGSWGYQATGLYAPTSRFGTPDEFRELIDAFHKAGIAVIMDWVPGHFPKDSFGLANF
DGTALYEHADPRRGEHKDWGTKIYNYGRREVNNFLTSNAMFWNKKYQVDGLRVDAVASML
YLDYSRKAGEWIPNKFGGHEDLEAVEFLKRTNELMYENCPGTATFAEESTAWPMVSRPTY
MGGLGFGYKWNMGWMHDTLDYMALDPIYRRYNHNKMTFGMLYAYNENFVLPLSHDEVVHG
KGSLLAKMSGDRWQKFANLRAYYGFMYGFPGKKLLFMGSEFAQDREWDYNGSLSWHLLND
PMHRGVQSVVRDLNKIYREMPALFEQDYDPQGFEWIDPNNADESVFSFIRYGKDKKDMAV
VVSNFTPVPRENFKLGVPKGGKYIEVFNSDAEIYGGSGMGNMGAVEATDEGWNNREHSVS
VTLPPLSTLIFVPQG

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	283	583	8.9e-160	0.9966777408637874
CBM48	127	212	3.6e-20	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	106	735	5	629	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	128	735	27	623	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	5	735	503	1224	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	103	733	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	5	735	1	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWK89955.1	0.0	10	730	23	742
AWJ85014.1	0.0	10	730	28	748
CCQ74842.1	0.0	1	734	3	733
QCO14159.1	0.0	10	730	28	748
QCO01680.1	0.0	10	730	28	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	2.04e-290	116	735	2	616	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	6.47e-288	120	735	1	611	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	7.62e-283	1	735	21	781	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR0_A	1.24e-281	1	735	21	781	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.24e-281	1	735	21	781	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1R5J4	0.0	1	735	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=glgB PE=3 SV=1
Q32AV3	0.0	1	735	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=glgB PE=3 SV=1
Q2RR72	0.0	10	735	10	734	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
Q3J3M6	0.0	7	733	13	727	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=glgB PE=3 SV=1
Q1AZ86	0.0	7	734	4	720	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004484_01355.