CAZyme Information: MGYG000004490_00572

Basic Information

• Species: Muribaculum sp003150235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp003150235
• CAZyme ID: MGYG000004490_00572
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36617.04	9.362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004490	3323418	MAG	Israel	Asia

• Gene Location: Start: 63640; End: 64602 Strand: -

Full Sequence      

MVYIRNIAKICVVAIAGVTFIWMPADVTAQQRSSTVFSSIENPVIPKSMTFAGKTIDFDR
VDMFERLDRELTSMAYTHGNTLLVLKRANKYFPELLPILKKNGVPEDMIYLACIESTLNP
RAYSGAKAAGLWQFIPSTAKQYGLEVNEYVDERYNTVKATEAACRYLKTAYGKYGNWESV
AASYNGGMGRISKEIEAQGEPSAYNLYLVDETARYIYRLLAMKLIMETPAKYGYHLKSDQ
LYQPVRTREVTVDYPVEDWAQWAKKQGVSYMQLRDFNPWIRAKSLPNKTAKAYTVLLPEK
SDLNRSTQQRKTYRDAWVVD

Enzyme Prediction     

No EC number prediction in MGYG000004490_00572.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	99	224	4.1e-22	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	8.10e-61	99	223	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.26e-30	65	278	82	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.85e-27	100	206	6	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	6.05e-15	115	221	11	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.59e-11	91	193	6	113	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35372.1	6.24e-164	33	320	46	333
ASB38769.1	7.74e-155	33	320	34	321
QQR09511.1	7.74e-155	33	320	34	321
ANU63153.1	7.74e-155	33	320	34	321
QCD43280.1	7.18e-143	24	320	32	328

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	7.06e-26	65	285	79	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	7.06e-26	65	285	79	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	5.34e-12	87	195	21	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	5.05e-06	101	193	70	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001075	0.998030	0.000268	0.000195	0.000186	0.000182

TMHMM  Annotations     

start	end
7	29