CAZyme Information: MGYG000004491_01652

Basic Information

• Species: Prevotella sp900548745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548745
• CAZyme ID: MGYG000004491_01652
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000004491_64|CGC1	36214.04	7.8412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004491	3066074	MAG	Israel	Asia

• Gene Location: Start: 7539; End: 8498 Strand: -

Full Sequence      

MMLVMASIVSAQAANKYDNPDTLFVARDGTAEFRNIDDAIEVCRAFMEYHKVIFVKKGLY
KEKLIIPSWLSNIEICGEDAENTIITCDDHANVFIPGTNRKMGTFRTYTVRVDGNDITFK
NITIENNAARLGQAVALNTQGDRLVFVNCRILGNQDTVYTGGVNTRVFFKDCHIEGTTDF
IFGPSTAWFENCTIYSRVNSYITAASTPQGVPYGYVFNRCKIVAAEGVDKVYLGRPWRPY
AHTLFMNCELGKHIRPEGWYNWNNPTNENTARYQEYNNSGEGAAPKKRVAWSRQLTKKEA
VQVTIENVFKRNDGWMPEK

Enzyme Prediction     

No EC number prediction in MGYG000004491_01652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	24	310	6.4e-100	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	8.68e-75	25	307	4	293	Pectinesterase.
PLN02773	PLN02773	2.34e-74	23	302	7	289	pectinesterase
COG4677	PemB	3.66e-63	25	312	87	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	4.72e-61	13	300	61	352	pectinesterase family protein
PLN02432	PLN02432	3.70e-60	25	301	15	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	1.07e-174	1	317	4	323
QVJ81978.1	2.50e-170	1	319	7	324
ADE82952.1	2.50e-170	1	319	7	324
AGB28242.1	6.37e-157	1	317	7	323
QJR97878.1	1.53e-156	5	319	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.98e-40	25	291	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.17e-40	25	316	11	308	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	8.96e-36	23	283	11	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.80e-35	23	283	11	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.42e-30	33	317	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.56e-53	25	300	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	4.03e-50	22	307	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	6.42e-50	22	307	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV6	8.28e-50	22	291	276	552	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q8GXA1	1.67e-48	25	318	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.852793	0.146817	0.000092	0.000154	0.000085	0.000087

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004491_01652.