CAZyme Information: MGYG000004491_01814

Basic Information

• Species: Prevotella sp900548745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548745
• CAZyme ID: MGYG000004491_01814
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		92435.02	8.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004491	3066074	MAG	Israel	Asia

• Gene Location: Start: 2224; End: 4695 Strand: +

Full Sequence      

MKNTILLSVVAMAVASTTTIAHASSLGDGNKHLLWYDKPAATWTEALPIGNSRLGAMVYG
TPATEHLQLNEETIWAGRPNNNPNPEAKEYLPKVRELVWKGKYKEAQDMATAHVMAKTNL
GMPYQPFGDLYVSFPGAGKYTEYYRELSLDSARVITTYKADGVKYKREYISSLSENVIMV
HLTASKPGMITCNANMTSPQQDVTIKSEGKEIVLSGISGWHEGLKGKVQFTGRATAQTKG
GQVVSSDGVLQIKNADEATIYLTIATNFKNYNDISGNDTLTSEKTLAEALKNSFEVIKEK
HYNIYRKQFDRVKLNLGKDMYAGKTTDWRVEHFKEHNDEYLVETYFQFGRYLLICTSQPG
TQPPTLQGIWNDKMLPSWDSKYTCNINLEMNYWPAELTNLSELNAPLFKLIKDVSQTGRE
SARVMYGADGWVLHHNTDLWRVTGAIDKAPSGLWPTGGAWLSQHLWEHYLYTGDKTFLAD
AYPTMKEAARFLNQIMVRNPNNTNWMICPSLSPENEHPHHATTAAGVTMDNELIHDLFNH
VIDASAILGKKEDKAFTDSLQNKLDGMLPLQTGRWGQLQEWKDDWDNPDDKHRHMSHLYA
LYPSNQISPFRTPQLTAAARTSLIHRGDPSTGWSMGWKVCLWSRLLDGNHALKLISDQLT
LVRNEKKKGGTYPNLFDAHPPFQIDGNFGCTAGIGEMLLQSHDGFVYLLPALPDAWTEGS
VSGLKARGGFEVSMEWKNNNIVKATVKSENGGNLRIRSSVPLAGKGLKEAKGENKNPLFK
TPRDVRQKINFPEKIEQMPALKKTYLYDIATKKGQTVELRMKK

Enzyme Prediction     

No EC number prediction in MGYG000004491_01814.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	31	758	3.1e-287	0.9792243767313019

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	5.35e-82	34	270	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam17389	Bac_rhamnosid6H	7.74e-04	447	558	84	200	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII62779.1	0.0	31	815	23	807
QQY43425.1	0.0	31	815	23	807
QUT83568.1	0.0	31	815	23	807
ABR40294.1	0.0	31	815	23	807
QJR76249.1	0.0	31	815	23	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	1.34e-262	24	816	14	801	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	4.10e-217	34	756	43	757	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	2.31e-182	36	748	7	744	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	4.74e-91	20	757	3	850	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	6.56e-91	20	757	3	850	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.61e-140	34	756	54	812	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	3.33e-90	34	742	23	762	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	2.22e-75	49	757	46	797	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	1.02e-62	24	756	10	714	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998981	0.000173	0.000212	0.000179	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004491_01814.