CAZyme Information: MGYG000004491_02193

Basic Information

• Species: Prevotella sp900548745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548745
• CAZyme ID: MGYG000004491_02193
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	MGYG000004491_118|CGC1	70061.04	6.0442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004491	3066074	MAG	Israel	Asia

• Gene Location: Start: 1446; End: 3341 Strand: -

Full Sequence      

MHSTGVIIENTHVLMKNTILTLFAALLVGMPMKAGDIYVSPAGNDLSAGTSASPLRTPAA
ALKLAREWRRLQKKDADGGINIHLEGGVYQLTKPLFLRPEDSGTADSPTIVSADATEAAV
ISGGQPLKGWTRGCTDSRVPQEIRGRVWVADAPMAGNRIVYCRQLWVNGHKAVRAQQGKY
GEMTRMKDFDVKSHTITIPTPQEDLSDARELEMTVHQRWAIAILRVKEMKNLGNGLPQVS
FHEPESQLEFAHPWPQPVIDGEKGSSSYFLSNAPQLLDEPGEWYQDYPSGKIYYLPREDE
DMAKAEAIVPVLENLLTVDGTRERTVHDIQFRNITFSHAAWTRPLTEGLVTLQGGFRMID
AYKLPEPGLPEKASLENQAWIARPEAAITVRHAQGIDFRKCRFEHLGATALDYETAVSHS
TVSGSRFTDIGGNAMLIGHFPDGGFETHVPYKPAVAGDLCDNITISDNEVCDATNEDWGC
VGIGAGYVSNINISNNEVHHVNYSGICVGWGWTPRESGMCNNRIIANYVHDFGRQLYDVG
GIYTLSYQPNSEIRYNRIEDLCEAPYATNERAFYIYFDEATDGYTVTDNWCPKELFGYNQ
PGPKMVIKGNGPKVDRRIKEKAGLKKQENKK

Enzyme Prediction     

No EC number prediction in MGYG000004491_02193.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	36	594	2.7e-194	0.9943074003795066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.85e-11	415	560	6	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	5.46e-06	386	556	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	4.95e-05	454	611	43	164	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	4.48e-04	482	589	2	108	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	0.002	381	556	37	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	3.58e-281	20	614	4	602
ALK85163.1	2.30e-277	15	623	46	654
QQY37289.1	3.73e-277	15	623	1	609
AII69040.1	4.74e-277	15	623	1	609
QUT84057.1	4.74e-277	15	623	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.03e-173	32	624	22	615	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.096699	0.895768	0.006708	0.000299	0.000235	0.000250

TMHMM  Annotations     

start	end
13	32