CAZyme Information: MGYG000004491_02292

Basic Information

• Species: Prevotella sp900548745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548745
• CAZyme ID: MGYG000004491_02292
• CAZy Family: GH33
• CAZyme Description: Sialidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224		25471.24	9.8271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004491	3066074	MAG	Israel	Asia

• Gene Location: Start: 28; End: 702 Strand: +

Full Sequence      

MVRSKDGGKTWSKRMPLQQDFLGPVKNKPVLSKGRLIAPTSIESDGWRLYFEYSDDMGKT
WKRTPYVATDSIMQDGKMRIKDLAIQPTIIFLSDGRLAALARTRSEHVAITYSSDNGETW
TKLKLLSLPNNNSGLDAVTLNNGMHVMICNEKPIPHGIKNGKGLRTPLSLMKSDDGENWH
HWITLEDSPISQYSYPSIIQTADGHIHCIYTWRRQRIKHIELLP

Enzyme Prediction     

EC	3.2.1.40	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	1	211	3.5e-29	0.5935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.25e-62	2	208	85	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	4.87e-41	1	222	115	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	5.47e-19	4	224	119	373	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	4.57e-04	3	175	5	156	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
cd15482	Sialidase_non-viral	0.001	87	214	17	188	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB58147.1	3.18e-72	4	224	141	352
ADY50909.1	3.36e-72	1	224	137	351
AOW08266.1	6.53e-72	4	224	141	353
QUT38411.1	8.54e-72	1	222	1044	1284
QGT69954.1	1.59e-71	1	222	1041	1281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004491_02292.