CAZyme Information: MGYG000004493_00010

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D
• CAZyme ID: MGYG000004493_00010
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35848.63	4.7931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004493	2547130	MAG	Israel	Asia

• Gene Location: Start: 10496; End: 11428 Strand: -

Full Sequence      

MVQTANKNAIPAAKKLLEYLYEISGKKIITGQHTQTVPMEEIGYIKSITGKEPKLRGFEL
LAYSPNINYAESDSECLTEVEENKNTVEQALKWASETSGILTFTFHWFSPLGGKDKSFYS
KNTDFDAEKVLIEGTEERKKFFSDMDSIAEILKKFSNIPVLWRPFHESYGDWFWWGEKGP
VVAGKLYEIMFDYYTNVHKLNNLLWVWNSDVKESYPGDDKVDVVSIDVYRPEYEPTDYSA
EYFKLCEGSSKNKVCALAEVGYIPDVSILEKTHIPWAYYMTWSKEFCIGEKYNTKDSLIK
MYESQYAVTL

Enzyme Prediction     

No EC number prediction in MGYG000004493_00010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	6	310	1.7e-92	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.75e-47	6	283	2	283	Glycosyl hydrolase family 26.
COG4124	ManB2	3.10e-14	135	262	157	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13973.1	5.00e-224	1	310	1	310
CBK82137.1	5.08e-158	1	309	1	311
QNM01251.1	5.06e-156	4	310	8	334
AOZ93051.1	8.89e-126	6	310	11	317
AIQ67637.1	2.54e-125	6	310	11	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.10e-55	6	309	8	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	5.15e-55	6	310	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.25e-43	13	310	43	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	9.81e-38	6	309	25	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6D2X_A	6.34e-34	5	295	5	321	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.18e-54	6	310	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55296	1.57e-48	6	302	159	448	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
Q5AWB7	2.23e-48	6	310	30	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55298	3.52e-47	6	302	158	447	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	9.72e-47	6	302	160	449	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004493_00010.