CAZyme Information: MGYG000004493_00023

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D
• CAZyme ID: MGYG000004493_00023
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		40234.59	5.7739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004493	2547130	MAG	Israel	Asia

• Gene Location: Start: 19692; End: 20783 Strand: -

Full Sequence      

MKKVALKFLALLFIFFPLYSKTSAEKLFDSLSEIEKISQIFLVNVEGNEIFHPVEFLEDG
TAVVPGGIILFSYNIGNSEEQLKNFISSINFFYKKNKSPLPFISVDQEGGEVNRLKKITS
HLPSEKKISENYTLQEAKSIYSSQAMQMKKLGITMNLAPVAEPEIESNKLFLETRTFGGV
PKSVAYSMVCVTAYEENGIASVAKHFPGNANSDPHTGSVEITLSSSEVFKNFIFPFALIL
KSNPSCVLVSHAKINSLDENPACMSSFWIKEILQSRLGFEGLVLSDDIFMGALSDLPPEQ
VAANAIISGVDVIMLSGKKFLSVAQSLLKLAENDEVFANRLYEAEKKVLDFKLKKGIIKI
EEK

Enzyme Prediction     

No EC number prediction in MGYG000004493_00023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	101	314	1.4e-36	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.42e-44	35	349	4	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	8.58e-42	35	359	5	319	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.57e-23	66	292	27	256	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.44e-05	199	359	204	360	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13960.1	2.87e-220	1	362	1	362
QQA00274.1	1.20e-112	30	359	33	364
QSI02896.1	5.11e-97	30	362	56	395
QTQ11429.1	2.87e-92	30	358	64	409
QTQ16630.1	2.87e-92	30	358	64	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VI6_A	1.09e-23	65	315	26	276	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
5BZA_A	1.16e-21	55	336	15	297	Crystalstructure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_B Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_C Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_D Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_A Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_B Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_C Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_D Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana]
6GFV_A	6.37e-21	99	314	72	298	Mtuberculosis LpqI [Mycobacterium tuberculosis H37Rv],6GFV_B M tuberculosis LpqI [Mycobacterium tuberculosis H37Rv]
5G1M_A	7.08e-21	66	290	48	268	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
3WO8_A	3.37e-20	65	336	40	308	Crystalstructure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44955	8.40e-25	42	340	5	304	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
P48823	5.50e-24	66	315	65	335	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	7.49e-24	66	292	29	258	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q4QLU8	1.07e-23	42	340	5	304	Beta-hexosaminidase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=nagZ PE=3 SV=1
A5UDA9	5.17e-23	42	340	5	304	Beta-hexosaminidase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000523	0.998451	0.000465	0.000186	0.000187	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004493_00023.