CAZyme Information: MGYG000004493_00575

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D
• CAZyme ID: MGYG000004493_00575
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000004493_2|CGC9	42604.22	8.8093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004493	2547130	MAG	Israel	Asia

• Gene Location: Start: 235811; End: 236977 Strand: +

Full Sequence      

MSKKKIVIAFAGGGTGGHIYPGIAIADELKKNSSESTETEIHWIGNSKGMDSAIIEKNLL
SSGGSISYFHGIPCGKLRRYFSLKNFTDLFKIFAGFIKSFFILKKIKPDFLFSKGGFVSV
PPCAAAAILKIPYFTHECDFTPGLATRINSKKASRILISYEETKKYFSGFQKEKCITTGN
PVRPAFYNDSSEAGKKFLGIKNDCKKNILLILGGSLGASQINNLVIECLDELKKDYIVVH
QTGKKFAQENPDIMSSGDDSYKPYEFIFNEMVSVIQSADVIISRAGANSLWECAVCSKPM
ILIPLCGAGTRGDQVDNAEYFASKGAAITLTGKDATKENLLNALAEMKNSETRNKFAENC
KYICKEKKPSEIIANLILEQIKNDVSCN

Enzyme Prediction     

No EC number prediction in MGYG000004493_00575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	209	362	8.2e-39	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.66e-126	3	383	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.12e-116	8	376	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.28e-102	6	382	1	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.59e-96	4	377	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	3.25e-80	4	366	2	340	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB14199.1	6.50e-265	1	382	1	382
QOS40075.1	1.38e-176	6	383	8	385
QQA00106.1	1.74e-162	2	378	4	380
QSI01832.1	8.72e-143	1	380	1	375
QTQ11918.1	5.82e-140	8	385	4	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	9.09e-28	13	365	10	340	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.07e-25	2	327	7	313	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	4.39e-21	3	345	7	320	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q73L91	3.83e-117	8	347	4	345	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) OX=243275 GN=murG PE=3 SV=1
B2S3B6	2.66e-88	2	347	10	345	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema pallidum subsp. pallidum (strain SS14) OX=455434 GN=murG PE=3 SV=1
O83535	2.66e-88	2	347	10	345	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema pallidum (strain Nichols) OX=243276 GN=murG PE=3 SV=1
O51708	1.42e-79	1	386	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=murG PE=3 SV=1
B7J0L2	1.42e-79	1	386	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Borreliella burgdorferi (strain ZS7) OX=445985 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004493_00575.